KEGG   Arachis duranensis: 107493037Help
Entry
107493037         CDS       T04300                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
adu  Arachis duranensis
Pathway
adu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:adu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107493037
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:adu03041]
    107493037
Enzymes [BR:adu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107493037
Spliceosome [BR:adu03041]
 Complex C
  Other components
   Step II factors
    107493037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 Helicase_C DEAD AAA_22 AAA_30 AAA_19 T2SSE ABC_tran AAA AAA_16 DUF2075 PhoH Sigma54_activ_2 AAA_7 Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 107493037
NCBI-ProteinID: XP_020980166
Position
A06
AA seq 611 aa AA seqDB search
MTINTYGKSAYDMPEWKKDAYGKTITFGQRSKLSIQEQRQSLLIYKLKKELIQAVHDNQV
LVVIGETGSGKTTQITHYLAEAGYTTRGKIECTQPRRVAATSAAIAKRVAEEFGCRLGEE
VGYAIRFEDSMGPDTVIKYMTEGMLLREILADENLSQYSVIMLDEAHERRTINTDVLFGL
LKQLVQRRPELRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYSKQPESDYLDAA
LITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEM
QSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPIS
QASAKQRAGRAGRTGPGKCYRLYTESAYRNEMPPTTIPEIQRINLAMTTLNMKAMGINDL
LSFDFMDPPSSQAIISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLG
CSDEILTIISMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFWGP
WCFENFVQSRSLRRAQDVRKQLLTIMDKYKLDVVSAGKNFTKIKKAHAARKDPQEGYRTN
FNIVSSLSNFM
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaatacttatgggaagtcagcctatgatatgccagaatggaagaaggatgct
tatgggaagaccattacttttggacaaaggtcaaagctttctattcaagaacagaggcag
agtctcctaatttacaagttaaaaaaagaattgattcaggctgtccatgataatcaggtg
ttggtggtaattggtgaaacaggttcaggcaaaactactcagattacacactatcttgct
gaagcaggttacaccacaagaggtaaaattgaatgcactcaacctcgtagggtggctgca
acgtcagctgcaattgcaaagcgagtggcagaagagtttggatgtcgattgggagaggaa
gttggttatgccattcggtttgaagattctatgggaccagatactgtaatcaagtacatg
accgaaggtatgcttcttagggaaatactggctgatgagaatctgtcacagtattctgtc
ataatgcttgatgaagcccatgaaaggaggaccatcaatactgatgttctttttggactg
cttaagcagctagtgcagcgtagacctgagttgcgattgattgtcacatctgccactctg
gatgcagagaagttctcaggatatttctttaactgtaacatctttacaatacccgggaga
actttccctgtggagattctttatagtaagcagccagaaagtgattacttagatgcagct
ttaatcactgtcctacagatccacttgacagaacctgaaggagacattcttctcttcttg
actggccaagaggagattgattttgcttgtcaatctctctacgaaagaatgaagggatta
ggtaagaatgttccagaactgataatattacctgtttatagtgcccttcctagtgaaatg
cagtctaggatatttgaccctgctcctcccgggaaaaggaaagtggttgtggcaactaac
attgctgaggcttctttgactattgatgggatattttacgttattgatcctgggtttgca
aagcaaaatgtttataacccaaaacaaggacttgattcattggtgataactccgatatca
caagcttcagccaaacaaagagctggacgtgcagggcgtactggacctggaaaatgctat
cgcctatataccgagagcgcatataggaatgagatgcctcccactacgattcctgagatt
caaaggataaatcttgcaatgactactctcaacatgaaagctatgggaataaatgatctt
ttgtcctttgattttatggatccaccatcatcccaagctattatttcagccatggaacag
ctctatagtcttggagcattggatgaagagggcctattaaccaaattggggaggaaaatg
gcagaatttcccttggatccacctttgtctaagatgttacttgccagtgtggaccttgga
tgtagtgatgagatattgacgataatttccatgattcagactggcaatattttttacagg
cctagggaaaagcaagcccaagcagatcagaagagggcaaagtttttccagcctgaaggt
gaccatctcacactgcttgctgtttatgaggcttggaaagccaagaatttttggggacca
tggtgttttgagaactttgttcaatctcgatcattgaggagagcacaggatgtcaggaaa
cagcttctcaccatcatggataagtacaaattggatgttgtaagtgctggaaaaaatttt
accaagatcaaaaaagcgcatgcagcaaggaaggatccccaggaaggctacagaaccaat
tttaatattgtatcatccctaagcaactttatgtga

DBGET integrated database retrieval system