KEGG   Arachis duranensis: 107495579Help
Entry
107495579         CDS       T04300                                 

Definition
(RefSeq) vacuolar-processing enzyme
  KO
K01369  legumain [EC:3.4.22.34]
Organism
adu  Arachis duranensis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:adu01002]
    107495579
Enzymes [BR:adu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     107495579
Peptidases [BR:adu01002]
 Cysteine Peptidases
  Family C13: legumain family
   107495579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 107495579
NCBI-ProteinID: XP_015972214
Position
A06
AA seq 487 aa AA seqDB search
MESLLRITLLFFAFTTFVASASGRRDIVGGTLRLPSEAISRFFHEPENEGTKWAVLLAGS
NGYWNYRHQADICHAYQLLRSGGVKEENIIVFMYDDIAYSEENPRPGVIINKPDGGDVYK
GVPKDYTGKDVNVNNFFAALLGNKSALTGGSGKVVDSGPNDHIFVFYSDHGGPGILGMPV
GPYLYANDLNEVLKKKHASGGYKSLVFYLEACESGSIFEGLLPEDINIYATTASNAVESS
WGTYCPGEDPSPPPEYSTCLGDLYSISWMEDSDTHNLRTETLHQQYKLVKDRTLNGNAYY
GSHVMQYGDVGISENLLFQYLGTNPANDNYTFVDENSLRTPSKAVNQRDADLIHFWEKFR
KAPEGSSSKITAQKQVVEVMSHRMHIDNSVKLIGNLLFGTEKGPELLSAVRPAGKPLVDD
WDCLKNMVRTFETHCGSLSQYGMKHMRTFANICNAGIHKDQMDEATAQACVSIPSNPWSS
LERGFSA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagtcccttctaaggatcacccttctcttctttgccttcactactttcgttgcgtcc
gcctccggccgccgcgacatagtcggaggtactctccggctgccctctgaggccatctcc
agattcttccatgagccagagaatgaagggacaaagtgggctgttcttcttgctggttcc
aatggttattggaactataggcatcaggctgatatttgtcacgcatatcaactattgagg
agtggaggggtaaaagaagaaaacataattgtgtttatgtatgatgacatagcttatagt
gaagaaaacccaaggcctggagtcataattaacaaaccagatgggggagatgtttataaa
ggtgttcctaaggattacaccggcaaagatgttaatgtcaacaacttctttgctgctctt
cttggaaacaaatcagctctcactggtggcagtggcaaagttgtagatagtggccccaat
gatcacatatttgtgttttacagtgaccatggaggtccagggattcttggtatgcctgtt
ggtccttacttgtatgcaaatgatcttaatgaagtcttgaagaagaagcatgcttctgga
ggatacaaaagccttgtgttttatctagaggcatgtgaatctgggagtatctttgaaggc
cttcttcctgaagacataaatatttacgcgacaacggcttcaaacgcggtcgagagcagt
tggggaacatattgccctggggaggatcctagtcctcccccagaatactcaacctgcttg
ggtgacctctacagtatttcttggatggaagacagtgacacccacaatttgaggacagaa
actttacaccaacaatataaattggtcaaagataggactttgaatggaaacgcatactat
ggctctcatgtgatgcaatatggtgacgtagggatcagcgagaaccttcttttccaatat
ttgggaacaaatcctgccaatgataattacacttttgtggatgaaaattccttgaggaca
ccttcaaaagcagtgaaccaacgcgatgcggacctcattcatttctgggagaagttccgc
aaagcgcccgagggttcttcgagtaagatcacggcacagaaacaagttgtggaagtgatg
tctcacagaatgcacatagacaacagtgtgaaactcattggaaatctcttatttggcact
gaaaagggtcctgaattgctaagtgcagttagacctgcagggaagcctcttgttgatgac
tgggattgcctcaaaaacatggtaaggacttttgagacacattgtggatccttatctcaa
tatggaatgaaacatatgagaacctttgcaaacatctgcaatgctgggatccataaagat
caaatggatgaggccacagcacaagcatgtgttagcatcccttccaatccatggagttct
cttgagaggggttttagtgcataa

DBGET integrated database retrieval system