KEGG   Acinetobacter defluvii: DJ533_04950Help
Entry
DJ533_04950       CDS       T05474                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
adv  Acinetobacter defluvii
Pathway
adv03010  Ribosome
Brite
KEGG Orthology (KO) [BR:adv00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DJ533_04950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:adv03011]
    DJ533_04950
Ribosome [BR:adv03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DJ533_04950
  Bacteria
    DJ533_04950
  Archaea
    DJ533_04950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF1442
Motif
Other DBs
NCBI-ProteinID: AWL27980
UniProt: A0A2S2FAP1
Position
547051..547380
Genome map
AA seq 109 aa AA seqDB search
MEVTAKLRGAAISAQKTRLVADLIRGKSVAHALNILNFSNKKAAVLVKKALESAIANAEH
NNSLDVDDLKVTTIYVDEGMSLKRIMPRAKGRADRITKRTCHITVKVGV
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaactgctaaattacgcggtgccgctatctcggcacaaaaaactcgtttggtt
gcagacctaatccgtggcaaatctgttgctcacgcgcttaatatccttaatttcagcaac
aaaaaagctgcggttttggttaaaaaagcattggaatctgcaattgcaaacgctgaacat
aataacagtttagatgtagacgatcttaaagtaactacgatttacgttgatgaaggcatg
agccttaaacgtattatgccacgtgcgaaaggccgtgcagatcgtattactaagcgtact
tgtcacatcaccgttaaggtaggggtttga

DBGET integrated database retrieval system