KEGG   Acinetobacter defluvii: DJ533_16160Help
Entry
DJ533_16160       CDS       T05474                                 

Definition
(GenBank) PHP domain-containing protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
adv  Acinetobacter defluvii
Brite
KEGG Orthology (KO) [BR:adv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DJ533_16160
Enzymes [BR:adv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     DJ533_16160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AWL29988
UniProt: A0A2S2FGF2
Position
complement(2860309..2861160)
Genome map
AA seq 283 aa AA seqDB search
MIGVDLHTHSNISDGTLTPEELIQAAHALGIKTFALTDHDTMDGVLRAKYCAANLGMQLI
SGVEISSQWSRPSTKKSYGVHIVALNMQNPEPLEKLLAKQKRIRAVRSKQICDLLIPLIG
QDIYADVIAKVDGEADRVTRTHIAKTLVEKGIVQRPQQAFDKYIKEGKKAYVKFDGLGLK
ETIEVIHDSQGFAVLAHPTRYDLSSTNIRYLIEIFAQFGGDAVELPPAIDTASTRQMVDR
MIAQFNLKVSVGSDFHGGHMPWIKLGNIPRVKEGQVGIWESFR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgattggtgtcgatttacatacgcatagtaatatttcagatggcacactcacgcctgaa
gagctgatccaagctgcccatgcattaggtataaagacctttgcattaaccgaccacgat
acaatggatggtgtattacgtgcgaaatattgtgctgcaaatttaggtatgcaattgatt
tctggtgtagaaatttccagtcaatggtcacgcccatccaccaaaaaaagttatggcgta
catatcgtggctttaaatatgcaaaatcctgaacctttagaaaagttacttgctaaacaa
aaacgcatccgagcagtacgttccaagcaaatttgtgatttgctgattcctttgattgga
caggatatttatgctgatgtcattgctaaagttgatggtgaagcagatcgtgtaacgcgc
acgcatatcgccaaaactttagtggaaaaaggaatagtgcagcgaccacaacaagccttt
gataaatatattaaagaaggtaaaaaagcttatgtaaaatttgatggtttaggacttaaa
gagaccattgaagtgattcatgacagccaaggctttgctgttttggcacatcccacacgt
tatgatttgtcttcaacaaatattagatacttgattgaaatttttgctcaattcggtggt
gatgctgttgagcttccacctgcaattgatactgcatctacccgacaaatggttgatcgt
atgattgctcagtttaatttaaaagtgtccgtggggagtgattttcatggtggtcatatg
ccttggattaaactaggcaatattccacgtgtaaaagaagggcaagtggggatttgggag
agctttcgttaa

DBGET integrated database retrieval system