KEGG   Aeromonas sp. ASNIH3: C2U39_00590Help
Entry
C2U39_00590       CDS       T05427                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea00860  Porphyrin and chlorophyll metabolism
aea01100  Metabolic pathways
aea01110  Biosynthesis of secondary metabolites
Module
aea_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:aea00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C2U39_00590 (hemN)
Enzymes [BR:aea01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     C2U39_00590 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AUV14649
UniProt: A0A2I8RA85
Position
103046..104419
Genome map
AA seq 457 aa AA seqDB search
MQAEQIVWDQALIEKYNYSGPRYTSYPTALEFNEGFGYPDFVQAAGQYPARNLSLYVHIP
FCHKLCYYCGCNKVITRHQHKADQYLDYLEQEIKAQAPLFKERLVTQLHWGGGTPTYLSD
PQTRRLMAMLREHFHFAEEGEISIEVDPREIELSMLDVLRELGFNRISLGVQDFNKAVQV
AVNREQDNDFIRAMLVRARELGFRSTNLDLIYGLPHQNRESFHHTLEEVLKTDPARLSIF
NYAHLPSRFAAQHKLKEADMPAPQEKLAMLQDTIAFLTGQGYQFIGMDHFAKPDDELAVA
QREGKLHRNFQGYTTQGDCDLLGLGVSSISMMGDAYSQNQKDLKTYYAQVESLGHAQWKG
CSLNRDDLIRREVIKRLICDFSLNFAAVEQAHGLVFKEYFAEDLKLLQTFIDDGLVRMTE
EGLEVVSTGQLLIRNICMCFDVYLRNKAREQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagcagaacagattgtgtgggatcaggccctgatcgaaaaatacaactacagtggt
ccgcgttatacctcctatcccactgcgctggagttcaacgaggggttcggctatccggac
tttgtccaggcagcgggccagtatcctgcgcgcaatctgtcgctctacgtgcatatcccc
ttctgtcacaagctctgctactactgcggctgcaacaaggtcattacccggcaccagcac
aaggcagatcaatacctcgactacctcgaacaggagatcaaggcccaggcccccctgttc
aaggagagactggtcacccagctgcactggggtggcggcacacccacctatctgagcgac
ccccagactcgtcgtctgatggccatgttgcgggagcacttccacttcgccgaggagggg
gagatcagcatcgaggtggatccccgcgagatcgaattgtccatgctggatgtgctgcgg
gagctcggtttcaaccgcatcagccttggcgttcaggacttcaacaaggcggtccaggtc
gcggtcaatcgggagcaggacaacgacttcatccgcgccatgctggttcgtgcccgcgag
ctggggttccgctccaccaatctggatctcatctacggtctgccgcaccagaaccgggag
agcttccatcacaccctggaagaggtgctcaagaccgacccggcccgcctctccatcttc
aactatgcccacttgccgagccgttttgccgcccagcacaagctgaaagaagcggacatg
ccggcgccgcaggagaagctggccatgctgcaggacaccattgccttcctgaccggccag
ggttatcagttcatcggcatggaccactttgccaagcccgatgacgagctggccgtcgcc
cagcgtgagggcaagctgcatcgcaacttccagggctataccacccagggggattgcgat
ctgctggggctgggggtctcttccatcagcatgatgggggatgcctattcccagaaccag
aaggatctcaaaacctactacgcccaggtcgagtcactgggccatgcccagtggaagggg
tgctccctcaatcgggacgatctgatccgtcgtgaggtgatcaagcgcctcatctgcgat
ttttccctgaacttcgccgctgtggaacaggcccacggcctggtgttcaaggagtatttt
gccgaagatctcaagctgttgcagaccttcatcgacgacggtctggtgcgcatgaccgaa
gaggggctggaggtggtctccaccggtcagctgctgatccgcaacatctgcatgtgcttc
gatgtctacctgcgcaacaaggcgcgcgagcagcagttctcccgggtgatctag

DBGET integrated database retrieval system