KEGG   Aeromonas sp. ASNIH3: C2U39_04135Help
Entry
C2U39_04135       CDS       T05427                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea00860  Porphyrin and chlorophyll metabolism
aea01100  Metabolic pathways
aea01110  Biosynthesis of secondary metabolites
aea01120  Microbial metabolism in diverse environments
Module
aea_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
aea_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:aea00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C2U39_04135 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aea01007]
    C2U39_04135 (hemL)
Enzymes [BR:aea01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     C2U39_04135 (hemL)
Amino acid related enzymes [BR:aea01007]
 Aminotransferase (transaminase)
  Class III
   C2U39_04135 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AUV11456
UniProt: A0A2I8QZ25
Position
complement(811557..812843)
Genome map
AA seq 428 aa AA seqDB search
MSKSDQLFEQARQTIPGGVNSPVRAFNGVGGTPRFIDHADGAYLYDVDGQAYVDYIGSWG
PMLLGHNHPAIKAAVIKAVEKGLSYGAPTEIEVLMAEKVRQIVPSMEQVRMVNSGTEATM
SAIRLARGYTGRDKIVKFEGCYHGHADSLLVKAGSGALTLGQPNSPGVPADFAKHTLTCV
FNDLDSVREAFTQYGSEIACIIVEPVAGNMNCIPPVPGFLEGLRAICDEFGALLILDEVM
TGFRVSLRGAQGHYNIDPDLTTLGKIIGAGMPVGAFGGKKKVMQHIAPTGPVYQAGTLSG
NPVAMAAGLTMLDLLLEPGLYEQLSAKTARVAEGLKAAAARHGIPLAINYVGGMFGFFFT
DETEITRYEQVTRCDMERFKRFYHLMLEEGIYLAPSAYEAGFLSLAHGDKEIEHTLAAAE
RSFAKLAG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatcagatcagctgtttgaacaggcccgccagaccattcccggtggcgtcaac
tcaccggtccgcgccttcaacggggtcggcggcacaccccgcttcatcgatcacgccgat
ggcgcctacctctatgacgtggacggccaggcctatgtggattacatcggttcctggggc
cccatgctgctcggccacaaccacccggccatcaaggccgccgtcatcaaggcagtggaa
aaagggctgagctacggtgccccgaccgagatcgaagtgctgatggccgagaaagtgcgc
cagatcgtcccctccatggagcaggtacggatggtcaactccggcaccgaggcgaccatg
agcgccatccggctggcccgtggctacaccggccgcgacaagatagtcaaattcgaaggc
tgctaccacggccacgccgactccctgctggtcaaggctggctccggcgccctgaccctg
ggtcagcccaacagcccgggcgtaccggccgatttcgccaagcacaccttgacctgcgtg
ttcaacgatctggactcggtgcgcgaagcctttacccagtacggcagcgagatcgcctgt
atcatcgtcgagccggtcgctggcaacatgaactgcatcccgccggtgcccggcttcctg
gaagggctgcgcgccatttgtgacgagttcggcgccctgctgatcctggatgaggtgatg
accggctttcgcgtctccctgcgtggtgcccagggccactacaacatcgacccggatctc
accaccctcggcaagatcatcggtgctggcatgccggtgggcgccttcggcggcaagaag
aaggtgatgcagcacatcgccccgaccggccccgtctatcaggccggcaccctctccggc
aacccggtggccatggccgccggcctcaccatgctggatctgctgctggagccgggcctc
tatgagcagctgagcgccaagaccgcccgtgtcgccgaagggctgaaagcggccgccgcc
aggcacggcatcccgcttgccatcaactacgtgggcggcatgttcggcttcttcttcacc
gacgagaccgagatcacccgctacgagcaggtgacccgctgcgacatggaacgcttcaag
cgcttctatcatctgatgctggaagagggtatctatctggcaccgagcgcctacgaggcg
ggcttcctgtcgctggcccacggcgacaaggagattgaacacaccctggcggccgccgag
cgcagcttcgccaagctggctggctga

DBGET integrated database retrieval system