KEGG   Aeromonas sp. ASNIH3: C2U39_16635Help
Entry
C2U39_16635       CDS       T05427                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
aea  Aeromonas sp. ASNIH3
Brite
KEGG Orthology (KO) [BR:aea00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aea03016]
    C2U39_16635
Enzymes [BR:aea01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     C2U39_16635
Transfer RNA biogenesis [BR:aea03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    C2U39_16635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AUV13635
UniProt: A0A2I8R5W6
Position
complement(3557469..3558248)
Genome map
AA seq 259 aa AA seqDB search
MMDEQTRTADALQPTLLYQDDWLVAVNKPSGLLVHRSWLDKAETRFAMQMTRDLIGGRHV
YPVHRLDRPTSGVLLFALDPAVARTLTEAFAARQVHKEYLALVRGWAPEEGLIDYPLKEQ
LDKIADAFSDPDRPAQEAVTAFRRLHQVELPFAVSKKHPTSRYSLVRLFPKTGRKHQLRR
HLDHLFHPIVGDTTHGDGRHNRFFREHYGCDRLLLIAHRLSFEHPVLKVPMRIQAPLGPE
VLGLFARLGWPASEQDYGA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgagcagacccggacagcggatgccttgcagccgactctgctctatcaggat
gactggctggtggcggtgaacaaaccgtccggtctcctggtgcaccgcagttggctcgac
aaggccgagacccgtttcgccatgcagatgacccgtgatctgatcgggggtcgtcatgtc
taccccgtgcaccgactggacaggcccacttcgggtgtgctgctgtttgctctcgatcct
gccgtggcccgtaccctgaccgaggcctttgctgcccgtcaggtccacaaggagtacctg
gcactggtgcggggatgggcccccgaagaggggctcatcgactatccgctcaaggagcag
ctggacaagattgccgatgccttcagcgacccggatcgccccgcccaggaggcggtgacc
gcgtttcgtcgtctgcatcaggtcgagctgcccttcgccgtctccaagaagcatcccacc
agtcgctacagcctggtccgcctctttcccaagacggggcgcaagcaccagctgcgccgc
catctggatcacctgttccaccccatcgtcggtgataccacccacggggatggccggcac
aaccgcttctttcgcgagcactacgggtgcgaccgcctgctgctcatcgcgcaccgtctg
agcttcgagcatccggtgctcaaggtgccgatgcggatccaggcgcccctgggccccgag
gtgctgggtctgttcgcccgtctgggctggcctgccagcgagcaagactacggcgcctga

DBGET integrated database retrieval system