KEGG   Aeromicrobium sp. A1-2: C6I20_02030Help
Entry
C6I20_02030       CDS       T05642                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aeb  Aeromicrobium sp. A1-2
Pathway
aeb00020  Citrate cycle (TCA cycle)
aeb00480  Glutathione metabolism
aeb01100  Metabolic pathways
aeb01110  Biosynthesis of secondary metabolites
aeb01120  Microbial metabolism in diverse environments
aeb01130  Biosynthesis of antibiotics
aeb01200  Carbon metabolism
aeb01210  2-Oxocarboxylic acid metabolism
aeb01230  Biosynthesis of amino acids
Module
aeb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aeb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C6I20_02030
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C6I20_02030
Enzymes [BR:aeb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C6I20_02030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AXT84093
UniProt: A0A3B7D4T8
Position
405173..407398
Genome map
AA seq 741 aa AA seqDB search
MAKIIYTHTDEAPMLATYSFLPVIEAYASTAGVEVETRDISLAGRIISLFGDHLTAEQQV
DDALAELGQLAKQPEANIIKLPNVSASIPQLKSAVAELQSQGYALPDYPDDPQTDAERDA
RSRYDKVKGSAVNPVLREGNSDRRAPASVKNYARKHPHSMGAWSSDSKTNVATMAQDDFR
ANEKSVVIESDGTIAILLIGDDGSTATLKDAFPVLAGEIIDGTVMRAAALDAFLTEQIAR
AKSEGVLFSVHLKATMMKVSDPVIFGHVVKAFFPAVFEQYGADLEAAGLSPSNGLGGILA
GLDALPNGAEIKAAFERGIADGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGHMW
GPDGDEADTLAVIPDSSYAGVYQTVIDDCRVNGAYDPTTMGSVPNVGLMAQAAEEYGSHD
KTFEIQTGGTVQVVDGAGRVLIEHSVEPGDVWRACQTKDVPIRDWVKLAVTRARASATPA
VFWLDPTRAHDVNLRAKVEAYLPDHDTEGLTIEVMSPADATQYSIDRIRRGEDTISVTGN
VLRDYNTDLFPILELGTSAKMLSIVPLINGGGLFETGAGGSAPKHVQQLIKENHLRWDSL
GEFLALASSFEHMATTTGNARAQILADTLDRATGTFLDENKSPSRKVGEIDNRGSHYYLA
LYWAQELAKQTEDAELAAGFAEVAEALTSNEDTINGELLSVQGSPADIGGYFRPDDAKVN
AVMRPSGTFTEVLQGLVARLG
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcatctacacccacactgacgaagcgccgatgctggccacgtactccttc
ctcccggtcatcgaggcgtacgcctcgaccgccggcgtcgaggtcgagacccgggacatc
tccctggccggtcgcatcatctcgctgttcggcgatcacctgaccgccgagcagcaggtc
gacgatgcgctcgccgagctcggtcagctggccaagcagcccgaggccaacatcatcaag
ctgcccaacgtcagcgcctcgatcccgcagctcaagtcggctgtcgccgagctgcagtcc
caggggtatgcgcttccggactaccccgacgacccccagaccgacgcggagcgtgacgct
cggtcccgctacgacaaggtcaagggcagcgccgtcaacccggtcctgcgtgagggcaac
tcggaccgacgtgccccggcctcggtcaagaactacgcgcgcaagcacccgcactcgatg
ggtgcgtggagcagcgactccaagaccaacgttgcgacgatggcacaagacgacttccgc
gcgaacgagaagtcggtcgtgatcgagtccgacggcacgatcgcgatcctgctgatcggt
gacgatggctcgaccgcgacgttgaaggatgccttcccggtgctggccggcgagatcatc
gacggcaccgtgatgcgggccgccgcgctcgacgcgttcctgaccgagcagatcgcccgg
gcgaagtccgagggtgtcctgttctcggtgcacctcaaggccaccatgatgaaggtctcg
gatccggtcatcttcggccacgtcgtcaaggcgttcttccccgctgtgttcgagcagtac
ggtgcggatctcgaggcggccggactcagcccgagcaacggcctcggcggcatccttgcg
ggtctcgacgcgcttcccaacggtgccgagatcaaggccgcgttcgagcgcggcatcgcc
gacggccccgccctggcgatggtcgactccgacaagggcatcaccaacctgcacgtgccg
agtgacgtcatcgtcgacgcgtcgatgcccgccatgatccgcacctcgggccacatgtgg
gggcccgacggcgatgaggccgacacgcttgcggtcatcccggacagctcgtacgccggc
gtctatcagaccgtcatcgacgattgccgggtcaacggcgcgtacgaccccaccacgatg
ggctcggtgcccaacgtcggactcatggcgcaggcggccgaggagtacggcagccacgac
aagactttcgagatccagaccggcggcaccgtccaggtggtcgatggtgccgggcgcgtg
ctgatcgagcactcggtcgagccgggcgacgtctggcgcgcctgccagaccaaggacgtg
ccgatccgcgattgggtcaagctcgccgtgactcgtgcccgcgcttccgcgacgcccgcg
gtgttctggctcgacccgacccgcgcccacgacgtcaacctgcgcgccaaggtcgaggcg
tacctgcccgatcacgacaccgagggcctgacgatcgaggtcatgtcaccggcggacgcg
acgcagtactcgatcgatcgcatccggcggggcgaggacacgatctcggtcaccggcaac
gtgctccgtgactacaacaccgatctgttcccgatcctcgagctcggcacgagcgcgaag
atgctctcgatcgtcccgctgatcaacggcggagggctgttcgagaccggcgccggcggg
tcggcgcccaagcacgtccagcagctcatcaaggagaaccacctccgctgggacagcctg
ggggagttccttgccctcgcctcgagctttgagcacatggcgaccacgaccggcaacgcc
cgcgcgcagatcctggccgacaccctcgaccgggccaccggcacgttcctggacgagaac
aagtcgcccagccgcaaggtcggcgagatcgacaaccgcggaagccactactacctcgcg
ctctactgggcgcaggagctggccaagcagaccgaggacgccgagctggcggccggattc
gccgaggtcgccgaggcgctgacctcgaacgaggacaccattaacggcgagctgctctcg
gtgcagggaagccccgccgacatcggcggctacttccgtccggacgacgccaaggtcaac
gccgtgatgcggccgtccgggacgttcaccgaggtgctccagggcctcgtcgcacggctg
ggctga

DBGET integrated database retrieval system