KEGG   Aeromicrobium sp. A1-2: C6I20_02235Help
Entry
C6I20_02235       CDS       T05642                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
aeb  Aeromicrobium sp. A1-2
Pathway
aeb00053  Ascorbate and aldarate metabolism
aeb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    C6I20_02235
Enzymes [BR:aeb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     C6I20_02235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind NmrA XdhC_CoxI Tachykinin
Motif
Other DBs
NCBI-ProteinID: AXT84127
UniProt: A0A3B7D8F2
Position
complement(451593..452378)
Genome map
AA seq 261 aa AA seqDB search
MKLLVTGAAGSIGSVLSRGLPALGHELRGLDLIPQADHNFTLGWLSGDCLDPAVADEAVA
GVDAVVHLAGTPHEDSLPAALESHVHTTARLLEAMLTHRVSRMVYASSNHAVGRTPRSEL
LTTDVRPRPDTFYGVAKVSAEALLSLYADRYDLDITAARIGTFGGAPTTARSLSTWLSPD
DAVRMVDAAVRSRQPGLHTIYGVSANTRGWWDLEPGRAIGYDPLDDAETHGGRVPNRDED
RAEAAYVGGPDATHLKPRPAF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcctcgtgacaggcgccgccggatcgatcggcagcgtgctgtcacggggactc
cccgcgctgggtcacgagctgcgcggactcgatctgatcccccaggccgaccacaacttc
accctcggctggttgagcggtgactgcctcgatccggcggtcgccgacgaggccgtggcc
ggcgtcgacgcggtggtccacctcgccggcactccccacgaggactcgctgcccgcagcc
ctggagtcacacgtgcacaccactgcgcggctgctcgaggcgatgctcacgcaccgcgtc
agcaggatggtctacgccagcagcaaccacgccgtcgggcgtacccctcgcagcgagctg
ctgacgaccgacgtccgcccgcggcccgacacgttctacggcgtggccaaggtctccgcc
gaagcgctgctgagcctctatgccgatcgctacgacctcgacatcacggccgcgcgcatc
gggaccttcggcggggcccccacgacggcacggagcctgtcgacctggctgtcacccgac
gacgcggtccgcatggtcgatgcggcggtcaggtcacgccagccgggcctccacacgatc
tacggggtctcggccaacacccggggctggtgggacctcgagccgggccgggcgatcggc
tacgacccgctcgacgatgccgagacccacggcggacgagtgccaaatcgtgacgaggac
cgagcggaggccgcgtacgtcggcggaccggacgccacccacctcaagccacgaccagcc
ttctga

DBGET integrated database retrieval system