KEGG   Aeromicrobium sp. A1-2: C6I20_11770Help
Entry
C6I20_11770       CDS       T05642                                 

Gene name
mca
Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
aeb  Aeromicrobium sp. A1-2
Brite
KEGG Orthology (KO) [BR:aeb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C6I20_11770 (mca)
Enzymes [BR:aeb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     C6I20_11770 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AXT86890
UniProt: A0A3B7D8Q7
Position
complement(2412918..2413769)
Genome map
AA seq 283 aa AA seqDB search
MHVHAHPDDESSKGAASTAKYVAEGVDVHVATCTGGERGSILNPGFEHSGITDNPELITE
IRREEMDRAREILGVKQDWLGFIDSGWPDGDPKPPLPEDCFALVPIEEAAAPLVRLIRSF
RPHVLTTYDENGGYPHPDHIKCHEISVYAYEAAADPDRYPELGEPWQVSKLYYQLSWNYA
RMKAIDDEMTKHGLDNPFAERLAKWERKPEDEARMTTQVECAEYFSVRDAALLAHATQID
PNGFWFAIPHQVQAEAWPTEDFQLVDSKVQTAIPETDLFAGLR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgcacgcccaccccgacgacgagtcgagcaagggcgctgcgtcgaccgcgaag
tacgttgccgaaggcgtcgacgtccacgtcgcgacctgcacgggcggcgagcgtggctcg
atcctcaatccaggattcgagcactccggcatcactgacaaccccgagctcatcaccgag
atccgacgcgaggagatggaccgggcgcgcgagatcctcggcgtcaagcaggactggctc
ggcttcatcgactcgggatggcccgatggcgatcccaagccaccgctgccggaggactgc
ttcgcgctcgtaccgatcgaggaggccgccgcgccgctcgtccggctgattcgttcgttc
cgcccgcacgtcctcacgacgtacgacgagaacggcggatatccgcaccccgaccacatc
aagtgccacgagatcagcgtctacgcgtacgaggcagccgcggatcctgatcgctacccc
gagctgggtgagccgtggcaggtctccaagctctactaccagctcagctggaactacgcc
cggatgaaggcgatcgacgacgagatgaccaagcacggtctcgacaacccgttcgccgag
cggctggcgaagtgggagcgaaagcccgaggacgaggcgcggatgaccacccaggtcgag
tgcgctgagtacttcagcgtgcgagacgcggcgctgctggcccacgcgacccagatcgat
cccaatggcttctggttcgcgatcccacaccaggtccaggccgaggcgtggcccaccgag
gacttccagctggtcgacagcaaggtccagacggcgatcccggagacggatctgttcgcc
gggctgcgctga

DBGET integrated database retrieval system