KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105142912Help
Entry
105142912         CDS       T03917                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase isoform X1
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00510  N-Glycan biosynthesis
aec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    105142912
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aec01003]
    105142912
Enzymes [BR:aec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     105142912
Glycosyltransferases [BR:aec01003]
 Glycan extension
  N-Glycan
   105142912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 105142912
NCBI-ProteinID: XP_011049106
Position
Unknown
AA seq 601 aa AA seqDB search
MKGKAHDSSIQGFAKQYPGCTLYTRKKSGGTVIAGGSRSARGILRTLVFIVLATFLWLQL
HVVSLTGRDDSGQSSSNETLFSLVPQELHRFLKEGRNSSTNLVNSSSGALTELEIAEIRH
KIERANAEQRVYNEEAFGPLASDAPIIVIQVHTRLTYLRHLIVSLAQAKDIEQALLVFSH
DVWHPDINYLVQSVDFCRVMQIYYPHSIQTHPHTFPGEGPNDCPRNIRKEQALNLKCTNA
KHPDLYGHYREAKFTQTKHHWWWKANRVFDQLSVTRNHTGMVLFLEEDHYVAEDFLHVLR
LMERTCKLSCERCNVLSLGTYLKTYNYFTDFSRKFLGVDSALQKELLRGLKRQEAAMAQR
QQIDSNGFGGIVTVTGGGGDGVNNVGGNAAVIGNGSTGGGGSVRGIGVGGVSSTYYQNAN
TMQAAPGWAFQLLPSLYNHYQKAEVTPWISSKHNMGMAFNRVTWNKLRKCAAQFCSYDDY
NWDWSLQYIAQTCVPSSRGAGIAPRAESGLITMTMRAPRVFHIGECGVHHKKNNCESTAV
IAKVQNVLNAARNHLFPSQLTLTIAGTAKKTKLRKGNGGWGDVRDHQLCWNMTISPDLDL
P
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaaagctcacgattcgtctatacaaggttttgcgaagcagtatcccggctgt
acactatataccagaaaaaagtcgggaggaacagtgatcgctggaggatcgcgatcggct
cgcggaattttgaggaccctcgtgttcatcgttttggctacgtttctctggcttcagctt
cacgttgtcagtttgactggtcgagatgattccgggcaatcatcatcgaacgagactctt
ttctctctcgtgcctcaagaattgcatagatttttaaaagagggacgtaactcgtccaca
aatttggtgaattctagctcgggagcgctcacggaactggagatcgcagaaatccgtcat
aaaatcgaacgagctaatgcggagcaaagagtgtacaatgaggaggcgtttggaccgttg
gccagcgacgctccaattatagtcatccaagtgcacacgcggctcacttatctacggcac
cttatcgtctcactagcgcaagctaaggacatcgagcaggctcttctcgtatttagccac
gacgtttggcacccagatatcaactatctcgtacaaagcgtcgacttttgcagggttatg
cagatctactatccacacagcatccagactcatcctcatacgtttcccggtgaaggaccc
aacgactgtccacgaaacattcgcaaagaacaggccttaaatttaaaatgcaccaacgcc
aaacacccggatttgtacggtcactacagggaggcgaaatttacgcagaccaagcatcac
tggtggtggaaagcgaacagggtgttcgatcaattgtcagtaacaagaaatcacaccggg
atggtcctctttctcgaagaggaccactatgtcgccgaagatttcttacatgtgcttaga
ctcatggagcgcacttgtaagctcagttgcgagagatgcaacgttctatcgttgggtaca
tatttaaagacgtacaactattttacggattttagtcgtaagttcctcggcgtcgatagt
gctctgcaaaaggagttgctgcgtggattaaagcggcaagaagcggcgatggcgcagagg
cagcaaatcgacagcaacggattcggcggcatcgtcaccgtcaccggcggtggtggcgac
ggcgttaataacgtcggtggtaacgccgccgtcatcggtaacgggagtaccggtggtggt
ggcagcgtcagaggcatcggcgtcggcggtgtgtcatccacctactatcagaacgcgaac
acgatgcaagcggcgcccggatgggccttccaactcctgcccagcctctacaaccattat
cagaaggcggaagttactccgtggatatctagcaagcacaatatgggcatggcattcaat
cgtgtcacatggaacaagctacggaaatgcgcggcacagttttgttcttacgacgattac
aactgggactggagtctgcagtatattgcgcaaacatgcgtaccgtccagtcggggcgcc
ggaatagcgcctcgcgctgaatccggattgatcacaatgacgatgagagctccgagagtc
ttccatatcggagaatgtggagtgcatcataagaaaaataactgtgaatcgacggcagtg
atagcgaaagtccaaaacgtcttgaatgcggcgcgcaatcatctgttcccttcgcaatta
acgttaacaattgccggaacggcgaagaagacgaaactccgtaagggtaatggtggatgg
ggagatgttcgagatcatcagctttgctggaacatgaccatatctccagatctggacttg
ccttga

DBGET integrated database retrieval system