KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105145127Help
Entry
105145127         CDS       T03917                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1-like isoform X1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00051  Fructose and mannose metabolism
aec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    105145127
Enzymes [BR:aec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     105145127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-GeneID: 105145127
NCBI-ProteinID: XP_011052812
UniProt: F4WH64
Position
Unknown
AA seq 453 aa AA seqDB search
MIEAEIVDIEVHDVRFPTSMWQIGNDSLHTNPNHACTYVIIHTNTKYKGYGIATTLGRGN
EFVVQTCKLLFRFVKKRMTTEIYSNFASFWKQLTTDVELRWLGAECGVVHLATAAIVNAL
WDLWARIEDKPVWKLLMDMTPEQLVSTVDFRYIRDVVTEEEAIEMLKKGQSRKEERKKIL
ESKGHPAYTADIGWSFNNQQIRSACKKFKKLEFKEYKIYVGPTIPVSWKKCNLIRNVIGK
RSDKILIVDANQFWDRDEAIFSVKSFNKTRPYFIEEPTSPDDVLGHVAIRAALKELKYPV
RVSCGETCANRVLFKQFLKFDGVDFWNINVGRLGGINEALAVYFMAKKHSIPVWGHAGEV
GSGEMIQHLQIWNFICLSEFTDIKIEYKSQQHGYFEDPVFIRNAAYLLPNRPGFSTQLKN
KCIMRWSYPEGTRWKYLFVTKHFKNELIYQKKL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagcggaaatcgttgatatcgaagtgcacgatgtaagatttccaacatcaatg
tggcagattggaaatgattcattgcatacgaatcccaatcatgcctgcacgtatgtaata
atccatactaacacgaaatataaaggatacggcattgcaactactttgggaagaggaaat
gaatttgtggtgcaaacatgcaagcttctgttcagattcgtaaaaaaacgaatgactaca
gaaatctattcaaattttgcatcattttggaaacagttaacaaccgacgtggaacttcga
tggctaggagcggaatgcggcgtggtacacttagctacagcagctatcgtgaatgctttg
tgggatctatgggcacgtattgaggataaacccgtctggaagttgttgatggatatgaca
cccgaacaactcgtttccactgtggattttagatatattagagatgtagtgaccgaggag
gaagcgatagaaatgctcaagaaaggccaatcgcgtaaagaggaaaggaagaagatatta
gaaagtaaaggacatccagcgtatacggccgacatcggatggtctttcaataatcaacaa
attagaagtgcttgcaaaaaatttaagaaactagaatttaaagagtataaaatatatgta
ggcccgaccatccccgtgagctggaagaagtgtaatctcatacgaaatgtgataggcaag
cgtagtgacaagatattgatagtggacgcgaatcaattctgggacagggacgaagcaata
ttttccgtgaaaagtttcaataaaacgcgtccctatttcatagaagaaccgacatctccc
gacgatgtcctgggacacgttgcgatacgagctgcactaaaagagttgaagtacccagtg
cgagtgagttgcggtgaaacgtgcgcaaatcgcgtcctattcaagcaattcttgaaattt
gacggggtcgatttttggaacattaatgtaggcaggctcggtggaattaatgaagcctta
gccgtatactttatggcaaaaaagcattcaataccagtgtgggggcatgctggtgaagtt
ggctcgggcgagatgattcaacatctccaaatatggaattttatttgcttaagtgaattc
acggatattaagatagagtacaaaagtcaacagcacggatactttgaagatcctgtattt
attagaaacgctgcttacctactgcctaaccgtccaggattttcaactcagcttaagaac
aagtgcattatgcgatggtcttatccggaaggtacacgatggaaatatttgtttgtaaca
aaacacttcaagaacgaactcatttatcaaaaaaagttatga

DBGET integrated database retrieval system