KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105146126Help
Entry
105146126         CDS       T03917                                 

Definition
(RefSeq) cyclin-dependent kinase-like 2
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aec01001]
    105146126
Enzymes [BR:aec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     105146126
Protein kinases [BR:aec01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   105146126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH FTA2 Kdo Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 105146126
NCBI-ProteinID: XP_011054525
UniProt: F4W3V9
Position
Unknown
AA seq 332 aa AA seqDB search
MEKYENIEIVGEGSYGLVMKCKHRETGQVVAIKKFLATEEDVQIRKMAFREIRMLKKLRH
ENLVNMIEVFRRRKRLYLVFEYLDHTVLDELEENKNGIDWEKSRRYIFQILRGLDFCHNH
KIMHRDVKPENVLVSPNGVIKLCDFGFARYITNESCTDYVATRWYRAPELLIGDSKYGRE
IDVWAAGCIYAEMVTGQPLFPGDSDIDQLYRITKILGPLYKSMNGSGKHILRHTKPDETV
SLTRSTSLRNLFPTWSSVAIDFLTQCLRTDPTFRPKCLTLLQHPFFLQDNFADRFLSELQ
RLVVKESAINLLGTKRAESSSRICRSSIGRLT
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatatgaaaatattgagatagtaggcgagggaagttacggactcgtgatgaaa
tgcaagcatcgcgaaaccgggcaagtagtggcgataaaaaagttcttggcgacggaagaa
gatgtacagattcgaaaaatggcatttcgtgaaataaggatgttaaagaaattacgtcac
gagaatttagtgaacatgatcgaggtgtttcgtcgaagaaaacggctttatctcgtattt
gaatatcttgatcacaccgtgctcgacgaattggaggaaaacaaaaatggtatcgattgg
gagaaatcaaggcgatatattttccaaatacttcgtggattggacttttgtcataatcat
aaaatcatgcatcgtgatgtaaagcctgagaatgtgctcgtatcaccgaacggcgtgatt
aagctttgcgactttggtttcgcacggtatatcactaacgagtcttgtaccgattacgtg
gcgacgagatggtatcgcgcaccagaacttctcatcggtgattccaagtacggtagagag
atcgacgtctgggcggccggatgcatctacgccgagatggtcaccggccagcctctcttt
cccggcgacagtgacatcgaccagctgtatcgcatcacgaagatcctcggtcctctttac
aaatcgatgaacggtagtggcaaacatatactccggcacacaaaacctgatgagactgtt
agtttaacacgatccacgagtcttcgaaatctctttccaacgtggagctcggtggcgatt
gattttttgacgcagtgtcttcgtacagatcctactttcagaccgaaatgtctcacgttg
ctgcagcatcctttcttcttgcaagacaatttcgccgacaggtttctcagcgagttgcag
cgacttgtcgtcaaagaatccgcgataaatttgctcggaaccaagagagcggaatcgtct
tctaggatctgtcgtagcagcattggaaggttgacttaa

DBGET integrated database retrieval system