KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105146329Help
Entry
105146329         CDS       T03917                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00010  Glycolysis / Gluconeogenesis
aec00562  Inositol phosphate metabolism
aec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105146329
   00562 Inositol phosphate metabolism
    105146329
Enzymes [BR:aec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105146329
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105146329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 ELM2
Motif
Other DBs
NCBI-GeneID: 105146329
NCBI-ProteinID: XP_011054804
Position
Unknown
AA seq 444 aa AA seqDB search
MLWKLSAKILIFCMVADISLASNYSKCNDSYRCRLGSKTPYRCVANYDESTLEYPDCVEK
KIWLIFRHGTRYPGKKYIPRMIEDLPELQHVILKNYENGATNLSADEAALFKKWKLSFTQ
GNMMKLAVEGENEMIDLGERYQARFPSLMPEAFNNQTYKFRFTATQRTEESARHFAVGLF
GWHNSKNVWYPLPVYRDRVIRFYKACPRWRQEVDKNLDAKLEKTKFLDGKIVRNMLDNIK
KRIGLNIDYETVNLMYTTCAFETALNQSIISPWCKIFSSNDFKIFEYVEDLEFYWIDGYG
YPLTYEQACAALKDMFDFFGSNEAAVTTAYFTHSGTILKLIALLGLAKDAHPLTHDSFVL
RKKEDKRAWRSSIIDTFATNMAFVLYDCEYYGPSVLFMLQERPVYLPGCPKDMPCPLNIM
KAIYPDRDEECQFDAMCHITKQGN
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgctttggaaattatctgctaaaattcttatattttgtatggtagcagatatttctctt
gcttctaattattccaagtgtaatgacagttacagatgtagattaggctcaaaaactcct
tatagatgtgtagctaattatgatgaatcaacattagaatatccagattgtgtggagaaa
aagatttggttgatttttcgtcatggaactcgatatccaggcaagaagtacatacctcgt
atgatagaagacttaccagagctgcaacatgtaatattaaaaaattatgagaatggagca
acaaatttgtcagctgatgaagcagctctgtttaaaaaatggaaactatcgtttactcaa
ggaaacatgatgaaattggcagtagaaggagaaaatgaaatgattgatctcggagaaaga
tatcaggcaagatttccatctctaatgccagaagcttttaacaatcaaacatataaattt
agattcactgccacacaacgtacagaagagagtgcaagacattttgctgttggtttattc
ggttggcataatagcaaaaatgtttggtatccattaccagtatatcgagatcgagtgata
agattttataaagcttgtcctcgctggcgccaagaagttgacaagaatttagatgcaaaa
ttagagaaaacgaaatttttggatggcaaaattgttagaaatatgttagacaatattaag
aaacgcattggtctcaatattgattatgaaactgtaaatttaatgtacacaacgtgtgct
tttgaaactgctttaaatcaaagtataatatctccctggtgtaaaatattttcatcaaat
gatttcaaaatctttgaatacgtagaagatctagaattctattggatcgacggatatggc
tatccattgacttatgagcaagcgtgcgctgccttaaaagatatgtttgatttctttgga
tctaatgaagcggcagtgacaacagcttattttacacattctggcacaattttaaaatta
atagccttactcggattagccaaagatgcgcatcctttaacgcatgactccttcgtatta
cgcaagaaggaagataaaagagcttggagaagcagtattattgatacgtttgcaactaac
atggcatttgttttgtatgattgcgaatattacggacccagtgtcttattcatgcttcag
gaacgaccggtatatttaccaggctgtccgaaagatatgccttgtccattaaatattatg
aaagcgatatatccagatcgcgatgaagaatgtcagtttgatgctatgtgccatataaca
aaacaaggcaattaa

DBGET integrated database retrieval system