KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105146862Help
Entry
105146862         CDS       T03917                                 

Definition
(RefSeq) ketohexokinase-like isoform X1
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00051  Fructose and mannose metabolism
aec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    105146862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aec04147]
    105146862
Enzymes [BR:aec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     105146862
Exosome [BR:aec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105146862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Bro-N HTH_Tnp_IS630 IL2RB_N1
Motif
Other DBs
NCBI-GeneID: 105146862
NCBI-ProteinID: XP_011055759
UniProt: F4W5L7
Position
Unknown
AA seq 385 aa AA seqDB search
MTSTDEQIIYEESSMEVHTLKILCVGRVCLDFVHVCTEYPSEDSTQRSTNYRWQRGGNAS
NTCTVLSLIGQPCELLACLSTDEHINFLQNDLRKYKIDYSHCPMINGIGCPVSSIILSLD
TGSRTIVYHNCLPELTLKNFEQLNLEEYSWIHFEGRHIDVVLLMIQHIDNYNNSLNCDLT
KNRMPITISVELESSRSGSGLLNLLSYVDVAFIAKEFAEYLGFSNMNEAIHNIGQDSKGT
IVCAWSEEGAIARTSCGSIVQSPAFPPQKVIDTLGAGDTFNAAALYYLNKSKVEFMHKYK
EEAACTNDNQMKDASDNNTAKRDVKENLDIRTSGKYNRAKFINETVLQQAIKFACCIAGA
KVGLRGYDCLDIISSDILQSNFLEN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacatctactgacgagcagatcatctatgaggaatcgtccatggaagttcatacgttg
aagattttgtgtgtgggacgcgtttgccttgatttcgttcacgtgtgcacggaatatcct
tcagaagattccactcaaagatctactaattacagatggcaaagaggaggcaatgcatct
aatacttgtactgtactatcattaataggacaaccatgtgagcttctggcatgcttgagc
acagacgaacatattaattttttgcaaaacgatctgcgcaagtataaaattgactattcc
cattgtcctatgataaatggtattggatgtcccgtctcaagtattatattgagtttggac
actggatctcgcacaattgtttatcataattgtttacccgaattgacattaaagaatttc
gagcaacttaatttagaagaatatagttggattcattttgagggaagacatatagatgta
gtgctacttatgatacagcatatagataattataataattcattaaattgtgatctcact
aaaaaccgcatgccaattacaattagtgtagaattagaaagttcgagatcaggttccggg
ttattgaatctattgtcgtacgttgacgtagcatttatagcaaaagaatttgctgagtat
ctgggtttcagtaatatgaacgaagcgatacataacattggtcaagattctaaaggaact
attgtttgtgcttggtcggaggaaggtgcaatcgctcgtacatcatgcggctcaatagta
caatcgccagctttcccacctcaaaaggtaatcgatactttaggtgcaggtgatacattt
aatgctgctgctctgtattatttgaacaaaagcaaagttgaatttatgcacaaatataaa
gaagaagcagcttgtacgaatgataatcaaatgaaggacgcctctgataataatactgca
aaacgagatgttaaggaaaatttagatataagaacttcggggaagtataatcgagcaaaa
tttattaatgaaacagttctacaacaggctattaaatttgcatgctgcattgctggtgca
aaagtaggattaagaggatacgattgccttgatataatttctagtgatattttacaatcg
aattttttagaaaattag

DBGET integrated database retrieval system