KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105146997Help
Entry
105146997         CDS       T03917                                 

Definition
(RefSeq) mono [ADP-ribose] polymerase PARP16 isoform X1
  KO
K00774  poly [ADP-ribose] polymerase 16 [EC:2.4.2.30]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105146997
Enzymes [BR:aec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     105146997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARTD15_N PARP Exotox-A_cataly
Motif
Other DBs
NCBI-GeneID: 105146997
NCBI-ProteinID: XP_011055988
Position
Unknown
AA seq 382 aa AA seqDB search
MAYSDQNYEIPKGIRARQNGQYEIPEEKTAAKAGLDVLHTSRIDRGITEEDVERKITTLK
QLLEKDPRAADLKWSLFVAASNTYRYDSCLKPFPPMYIKNECKDIEALRRVIESVPPLLV
ICKELGETDVYQNYGEIIELLYWVLLRLRDPYIKSVQKEYYNSILRKVPLEVPVAAPNLI
FQMASAKQSTSEEKWKSNAKGHSTFYAYHGSRLENFHSIVHYGLQQNMCKRSQFGKGIYF
SSELGVSLPYSPVGYGWGGSLLGSEISCIALCELINHPDIKRGDSRDNAQNTLSDSVSGR
IPEKYFVVTNSDLVRIRYLLVYTQDLHTTSTTDSTGLLAWFKQHKLLTFVLGYVVLLASV
GLTQNKQVEKYYRLFIQKAGFE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcatactctgatcagaattatgagatacctaaaggtatcagagcaagacagaatgga
caatatgagattccagaagaaaaaactgcagccaaggcaggtttagatgtattacataca
tctcggatagaccgcggtataactgaggaagacgtggaaagaaagataacgacactgaaa
caattattggagaaagatccaagagctgccgatttaaaatggtccctttttgtggcagca
tccaacacttaccgttatgatagttgtttaaaaccgtttccgcctatgtacatcaagaac
gagtgcaaagatatcgaagcattgaggagagtcatagaatcagtccctcctttgctcgtg
atatgcaaagaactcggtgagacagatgtctaccaaaattacggcgaaataatagagtta
ttgtattgggtactgctgcgattaagagatccatacattaaaagtgtacagaaagaatac
tacaattccatactgaggaaagtgccattggaagtaccggttgcagcaccaaatcttata
tttcaaatggcaagtgcgaaacaatctacgtcagaagagaaatggaagtcaaatgctaaa
ggtcactcgacattttatgcgtatcacggcagccgtttggaaaacttccattccatcgta
cactatggtttacaacaaaacatgtgcaaaagatcacagtttggcaaaggaatatatttt
tcaagcgaattaggagtaagcttaccgtacagtcctgtgggttatggctggggaggtagt
cttcttggaagcgagataagctgtatagctctctgtgagcttattaatcatcctgatata
aagagaggagattcaagagataacgcacaaaatacattgagtgattcagttagtggaaga
ataccagagaagtactttgtagtgacaaatagcgacttagtgaggatacgctatttgctc
gtttatactcaagatctccatacaactagtactactgatagtacgggattgctggcatgg
ttcaagcaacacaaattactgacatttgtgctcggctacgttgtgctgttagcctcagtt
ggactaacacagaacaaacaagtagaaaaatactataggttatttattcagaaagcagga
ttcgaataa

DBGET integrated database retrieval system