KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105147201Help
Entry
105147201         CDS       T03917                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase pitchoune
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aec03041]
    105147201
   03009 Ribosome biogenesis [BR:aec03009]
    105147201
Enzymes [BR:aec01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     105147201
Spliceosome [BR:aec03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    105147201
Ribosome biogenesis [BR:aec03009]
 Eukaryotic type
  90S particles
   Helicases
    105147201
  Pre-60S particles
    105147201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4217 Helicase_C DEAD
Motif
Other DBs
NCBI-GeneID: 105147201
NCBI-ProteinID: XP_011056358
Position
Unknown
AA seq 405 aa AA seqDB search
MQTFGVLEDLMKYHYHIYSLLLDGANRQTEAHTLEKGINIIVAMPEQLLDHLQNTPDFFY
KNLQCLIIDEXDRILGIGYEEQLKXVNILPKRRQTILFSTYTQGSNDNKISAKKKPIYVE
VDNDKEMTTMEGLQQGYIACXSDKRFLLLFTFLKKNKKKVMVFFNSCISVKYYHELLNYI
DLPAMNVHSKQKQMKRITTFHQFCNAFSGILLCTKDAAKDLDTXCRYWIVQYDQPDDPIE
YIHRIGRTVRGDNSSGHALLILXSQELDFLRYLEIVRVSINEYEFSWKKITDIQLQLEKL
ISKNYILYQSTKEAFKDYVRAYYSHYLEQIFDFIENLDLAKVAKSFGFIVPPAINLKISK
SSRPQKRLSGGGYGHFKNINDPSSAKWLKRIKIFRQLGKRGQDNR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttcggagtcttggaagacttaatgaaatatcattatcacatatatagtctt
ctactggatggtgccaatagacagaccgaagcgcatacactcgaaaaagggatcaatatt
atcgtggcaatgccagaacagttattagatcatttgcaaaacacacctgatttcttctat
aagaatcttcaatgtttgataattgacgaannggatcgtattttaggtattggatacgag
gaacagttgaaantcgtcaatattcttcccaaacgtcggcaaactatcctcttcagtact
tacacacaaggtagcaatgataacaaaattagcgctaaaaaaaaacctatatatgtggaa
gtcgacaacgacaaggaaatgacgactatggagggcttacagcaaggttacatagcatgt
ncaagtgacaaaagatttctacttttgttcacattcttaaagaaaaacaaaaaaaaagtg
atggtcttcttcaattcttgcatatctgttaaatattaccatgaacttttaaactacatt
gatttaccagcgatgaatgtacatagcaagcagaaacagatgaaaagaattacgaccttt
catcaattttgcaacgctttttcgggaattttgctctgcactaaagatgccgcgaaagat
ctggatacctaatgtcgatattggatcgtgcagtacgatcaaccagatgatcccatagaa
tacatccatcgtattggtcgaaccgttcgcggagacaatagtagcggtcatgcattgttg
atattatgatcacaggagcttgacttccttcgttatctcgaaatagttcgtgtatctata
aacgaatacgaattctcttggaaaaaaattactgatatacaattacagcttgaaaagtta
atatcgaagaattacatcttataccagtcgacaaaggaagccttcaaagattatgttaga
gcatattattcacattatttggagcagatttttgattttatagaaaatctggatctggcg
aaagtcgccaagtctttcggatttattgtaccaccggcaataaacttaaaaattagtaag
tcttcacgaccacaaaagagactcagcggaggcggttacggacatttcaaaaatataaac
gatccgagttcggcaaaatggctgaaacgcatcaagatctttcgccagctaggcaaacgt
gggcaggataatcggtaa

DBGET integrated database retrieval system