KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105147383Help
Entry
105147383         CDS       T03917                                 

Definition
(RefSeq) cysteine--tRNA ligase, cytoplasmic
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:aec00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105147383
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aec01007]
    105147383
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aec03016]
    105147383
Enzymes [BR:aec01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     105147383
Amino acid related enzymes [BR:aec01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   105147383
Transfer RNA biogenesis [BR:aec03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    105147383
 Prokaryotic Type
    105147383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1c DASH_Dad2 PsbQ
Motif
Other DBs
NCBI-GeneID: 105147383
NCBI-ProteinID: XP_011056663
UniProt: F4WNS7
Position
Unknown
AA seq 732 aa AA seqDB search
MAKRTQPTWHLPDRKDAMVLRLYNSLTREKEIFVPQFGNRVLWYSCGPTVYDASHMGHAR
SYISFDILYFGYDILYVMNITDIDDKIIKRARQNYLYEKYVEENHSLNSILDDVKEVMSN
FENVVRTTSSADKKCMLEQMLYKITRTIEDLQKAVKEKDEKKIIRFQDALLKEAKDPLAD
WLDKIKGSTITEHSIFNKISKHWEAEFHKDMDALNILKPNVLTRVSEYVEEIITFIQQII
DNGYAYESNGSVYFDVDKFDKQEKHSYAKLVPEAYGDTSSLEEGEGDLSTTADKLSEKKS
VTDFALWKCSKAGEPWWESPWGRGRPGWHIECSVMASAICGESLDIHTGGVDLKFPHHDN
ELAQAEACFNNSHWVRYFLHSGHLTIAGCKMSKSLKNFVTIQDALKKYSSRQLRLAFLLH
SWKDTLDYSDNTMNMAVQYEKFLNEFFLNIKCKIRSLGTNTTTTIDSFIKWSNLEVKLNE
KFYLAKHSIHKALCDNIDTRTVLNLIRELVTNCNVYMSQSKNPNLLLLRDIAVYITKIFT
IFGAVSSSYNSIGFPINDEIVNTNVEETVMPYVEILVNFREKVRNCAKTLKAKDILQECD
QLRDDILPNVGVRLEDSNEGECKVKLVNREELLKEKEIKKKLELEKILEKEKIKAETAAV
AAAKEAQKRISPSDMFRLEKDKYSQFDDKGLPTHDAEGKEISKSLFKKLQKLQQAQEKKY
NEYLASTQNGCL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggccaagagaacacaaccaacttggcatctaccagatagaaaggatgccatggtactg
cgattgtacaacagtttgactagagagaaggagatatttgtcccgcagtttggaaatcgt
gttttgtggtacagttgtggacctactgtctatgatgcatctcacatgggtcatgcaaga
tcatatatatcttttgatattctgtattttggatatgatatcttatacgtgatgaatatt
actgatatagatgataagatcataaaaagagcaagacagaattatctgtatgaaaaatat
gtggaagaaaatcacagccttaatagtatattagatgatgtcaaagaagtaatgtctaat
tttgaaaatgttgtaagaactacaagtagtgccgataagaaatgcatgttagaacaaatg
ttgtataaaataacaagaactatcgaagatctgcagaaggcagtaaaagagaaggatgaa
aaaaagattataaggtttcaagacgcattattgaaagaggctaaagatcctttagccgac
tggttagacaaaatcaaaggtagcacaattacggaacattccatatttaataaaatatcg
aaacattgggaagctgaatttcataaagatatggacgctttaaatatattaaaaccaaac
gtactcacaagagttagcgaatatgtagaggagataataacatttatacaacaaataata
gataatggatatgcttatgaaagtaatggatcagtatactttgacgtagacaaatttgat
aaacaagagaaacattcttatgccaagcttgtaccagaagcgtacggcgatacgtcaagc
ttagaagagggagaaggcgatttgagtactacagcagataaactctctgaaaagaaatcg
gtaacagactttgcactttggaaatgttcaaaggcaggtgaaccttggtgggagagtcct
tggggcagaggacgtccaggatggcatattgaatgctcggtcatggcgtctgcaatttgt
ggagaaagtttagatatccatacaggcggagtagatcttaaatttcctcatcatgataat
gaacttgcgcaagcagaagcatgtttcaataactcacattgggttagatatttcctgcac
tctggccacttgactatagctggctgcaagatgtccaaatcgctaaagaactttgtaacg
atacaagacgctttaaagaaatattcaagtagacaactcagacttgcttttcttctgcat
tcatggaaagacactttagattatagtgataatactatgaatatggctgtacaatatgaa
aaatttcttaatgaattttttttaaatataaaatgtaagattagaagtttgggaacaaat
actactactactattgatagttttattaaatggtctaatttggaagtgaaactcaatgag
aaattttatcttgcaaagcattctatacataaagcattgtgcgacaatattgatacaaga
actgttctcaatttaatacgggagctcgtgacaaattgcaatgtgtacatgagtcaaagt
aaaaatccaaacttgcttcttcttagggatatcgccgtgtatattacgaagatatttacc
atttttggagctgtttcttcttcgtacaattcaattggatttccaattaatgatgagata
gtcaatacaaatgttgaagaaactgttatgccatatgttgaaattctggtgaatttccga
gaaaaagttcgaaattgtgcgaaaactttgaaagcgaaagatattttacaagagtgcgat
caattgcgggatgatattttacctaacgttggtgtgcggttggaagatagtaacgaagga
gagtgtaaagtaaaattagtcaacagggaagagttgttgaaggagaaagaaattaagaag
aaactagaacttgagaaaatcttagagaaggaaaaaataaaagcagagactgctgctgta
gcagcagcaaaagaagcgcagaaaagaatatcgccaagcgatatgttcagattggagaaa
gataaatattctcaatttgatgataagggattaccaacacatgatgccgaaggtaaagaa
attagcaaaagtttattcaagaagttgcaaaagttacagcaagcacaagaaaaaaaatat
aatgaatatttggcttccacgcaaaatggttgcttataa

DBGET integrated database retrieval system