KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105147828Help
Entry
105147828         CDS       T03917                                 

Definition
(RefSeq) FK506-binding protein 59 isoform X1
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aec03110]
    105147828
Enzymes [BR:aec01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     105147828
Chaperones and folding catalysts [BR:aec03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    105147828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_12 TPR_11 TPR_15
Motif
Other DBs
NCBI-GeneID: 105147828
NCBI-ProteinID: XP_011057415
Position
Unknown
AA seq 503 aa AA seqDB search
MIVKSRLHDYFESAGTRIGSWKIAQFEQDSLLRISERIPFSQIRMAEIDLSPAQDRGVLK
KIIKEGEGDLTPTNGCRVKVHYKGTLLDGTKFDASRKNKPFHFSLGINSVIKGWDIGVAT
MKKGEIAMLTCAPEYAYGKNGSPPLVPTDATLKFEIELLDWFGEDLSPNKDKSIERFQIV
AGQNYAHPEEDSIVKIHLTGRYNGQVFEDRDVEFVLGEGEVAGIIDGVDIALQRFLKNEK
SKLLIKSKYAFKEQGNPEFNIPPNADVEYEVELQNFEKEANIWSMKSPEKIEQAKMQKEK
GTKYLTSDKINFAIKMYQKVFKYLNDASSFEDDSKKERDNLVIATHLNLALCYLKTNENI
LARDECTKALELDSQNEKALFRRGQAHLGLSSPEIAINDFQKVLEVQPKNTAASKQILIC
NSLIKKQLAKEKKLYANMFDKFAQEDKQKEEQKLKEQPDVMRGTLGEWGQEERPGGRDAT
AFEKENPNILMLNANGSGEFKNM
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgaagagtcgactacacgattatttcgaatcagccggcacgcgtattggaagt
tggaagattgctcaattcgaacaagattctctactgcgtatatctgaacgcatcccattt
tcgcaaatcagaatggccgagatagatttgtctcccgcacaggaccgcggcgtgttgaag
aaaatcatcaaggaaggagaaggagatttgacccctacgaatggttgtagagtaaaggtc
cactacaagggtactctgctggatggcaccaagtttgatgccagcagaaagaataagcca
ttccactttagtctcggaattaacagtgtcattaaaggatgggacattggcgttgctacc
atgaagaagggtgagattgctatgctgacctgtgctcctgaatatgcctatggcaagaat
ggtagtccaccattggttccaactgatgctacgttgaagtttgaaattgaattgcttgat
tggttcggagaagatctatctccgaataaagataagagtattgagagattccaaatcgtt
gccggtcaaaactatgctcatccagaggaagatagtattgtaaaaatacatttgactgga
agatacaatggtcaagtatttgaagatagagatgtagaatttgttcttggagaaggagaa
gttgcaggaattatagacggtgtagacatagcattgcagcgcttcttgaagaatgagaaa
tctaagctgctaattaaaagcaaatatgcatttaaggaacaaggaaatccggaatttaat
attccaccgaatgcggacgtagaatatgaagtggaattacagaacttcgagaaggaggca
aatatatggtcaatgaaatcaccggaaaaaatagaacaagcaaagatgcagaaagaaaaa
ggaacgaaatacttgacttccgataaaatcaatttcgccattaaaatgtaccagaaagtt
ttcaaatacttaaatgatgcatcgagtttcgaggatgattccaaaaaagagagagataat
ctcgtaatagcgactcacttaaacctcgctctatgttacctgaaaaccaatgaaaatatt
ttggctagagacgagtgtactaaagctttagaactggattcgcagaatgaaaaggctctg
ttcagaagaggacaagcgcatcttgggctctcatcacctgaaattgctattaatgatttc
cagaaggttctagaagtacaaccgaaaaatacggccgcgtctaaacaaattttaatctgt
aattctcttattaagaagcaattagctaaagagaagaaactttatgcgaacatgttcgat
aagtttgcgcaggaagataaacagaaggaggagcaaaaactgaaggaacagccagacgtg
atgcgtggaactctaggagaatggggacaggaagaaagacccggaggtagagacgcgact
gccttcgagaaggaaaatcctaacatacttatgctcaacgctaatggttctggtgaattc
aaaaacatgtaa

DBGET integrated database retrieval system