KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105147900Help
Entry
105147900         CDS       T03917                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec03013  RNA transport
Brite
KEGG Orthology (KO) [BR:aec00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    105147900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:aec03012]
    105147900
Translation factors [BR:aec03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    105147900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 105147900
NCBI-ProteinID: XP_011057542
UniProt: F4WQJ8
Position
Unknown
AA seq 1154 aa AA seqDB search
MARYGQRPENALKRANEFIEVGKPARALDTLQEVFRNKKWTYNWSESVLEPIMFKYLDLC
VELKKSHIAKEGLFQYRNMFQSVNVGSLENVIRGYLKMAEEKTNAARKQSQQAVIDIDDL
DNLATPESILLSAVSGEDAQDRSDRTILTPWVKFLWESYCQCLELLRTNAHVETLYHDIA
RMAFQFCLEYNRKTEFRKLCEKLRKHLEEICKLPPLVSNVSMNKAETQQLNLETRLNQLD
SAIQMELWQEAFKSSEDVHGMMNLSKKLPVPKTMANYYQKLAMVFWKAGNYLFHAAALFK
LLQLSREMKKNMSSEEQQRMANRVLLATLSIPLPSAHPEFDRFIETDKSPLEKAQKLATL
LGLSQPPTRVSLLKDIVRLNVVVLASPQLQELYSWLEVEFHPLELCSRVDSVIQTLQADE
NSPLIQYIPALQDVTLVRLVHQISQVYQTIQFSRLLELAKFTIDFHLERLLVDCVRYNDM
QIRIDHGKSCVHFGVDLSEAQREDHPDGPVLQAMPSEQIRCQLVNMATVLHRAINVINPN
KKKFEREKVRNVLVAHYHETKIKDHQKILGRHKIIEERKEYIEHINTVREEEEMRRQEEL
QRQQMLAEQKRLEQEREERERKRQQSEIQQIKDRHLKEKMQQISQTSHGQKVLKKLDEDE
IKKLDAEQIAAREAEELQKERREMQQKLKSQEKKVDYLERAKRLEEIPLLEKAVQDRMQQ
AKQLWRQQEDERIAAAIEERQEAVATQERLARMKEDHGIFLAKILAERRNIYTEKLKEFE
KLLNEERVKRLLKRKMDRKAERKAKWEKERAEAAERRRLEELRIKQEEEKKRLEEERAKR
EEEERIRRVEEEAREAERMAKLKKQAEIIRAKEAEIERKLEEERLRDKELTSTWRRGMDN
DRDRDRDRDRDRDRDRERERDRDRDRDRDRDRERDRDGPKPSMESWRRNPDKDSDGLKND
TDRWRKRDDKIEDSSWKRREPEREPRRDMDKWRRNDDSDRWKKDTMEKWRKDDNYDREDL
RDRDRLDNRGFDKRDDRDRDRDRDRDRERGIEGRGIREIPRDTIRDDRDRDRDRDRDRDR
GRMSDRRGGYRDRRDEPARPNTNQDWRKRDPPQDSPRDPPKREREDRKDDRLPPRSDERR
RPLEDDGWSKVSRR
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgttacgggcaaaggcccgagaacgccctgaaacgggcgaatgagttcatagaa
gtgggtaaaccagctcgagcattagatacgttacaagaagtcttccgtaataaaaaatgg
acgtacaactggtcagagtccgttttggaacctataatgttcaagtatctggatctttgt
gtggaactaaagaagtcacacatagcgaaagagggcttgttccaatacagaaatatgttt
caatccgtcaatgttggcagtttggaaaatgttatacgtggttatttgaaaatggctgaa
gagaagactaatgcagcacgcaaacagagtcaacaagcagtaattgacattgacgatctt
gataatcttgccacacctgagagcatcttactgtcagccgtaagcggtgaagacgcgcaa
gacaggagcgatcgtactattttaacaccctgggtgaaattcttgtgggaatcgtactgc
caatgcttggagttgctcagaactaatgcgcatgtagaaactctttaccatgatatcgca
cgtatggccttccagttttgcctcgagtataatcgtaagactgaatttcgcaagttatgc
gagaaattgcggaagcatcttgaagagatatgtaaactgcctccgctcgtgtcgaatgtt
tctatgaataaggcagaaacgcaacagttaaatctagaaactagattaaatcaattagat
tctgcgatacaaatggaattgtggcaggaagcctttaaatcttcggaggacgttcacggt
atgatgaatttgtcgaagaagctgcctgtaccaaaaacaatggccaattattatcagaaa
ttggctatggttttctggaaggctggcaattatctgtttcatgcagctgcactgttcaaa
cttttacagctctctcgggaaatgaaaaagaatatgtcctcggaggaacagcagcgaatg
gccaatcgggtattattggcaacgttgtcgataccgttgccatccgcgcatcctgaattt
gatcgtttcatagagactgacaagagtccgctagaaaaagctcaaaagctcgcgactctt
ttaggtctctcgcaaccaccaacacgcgtctctctgttgaaggacattgttcgtttgaat
gttgtcgttctcgcgtcaccacagttgcaagaattatattcatggttagaagtggaattt
catccgttagaactctgtagcagagtcgattccgtcattcaaacgttacaggcagacgaa
aacagtccgttaatccaatacatcccagccttgcaggatgttacacttgtgcgtcttgtt
catcagatttctcaagtttatcaaactatacaattttccagactcctggaacttgccaaa
ttcaccatcgattttcaccttgaacgtcttttggtagactgcgtacgctataatgacatg
cagatcagaatagatcacggcaagtcatgtgttcacttcggagtggatctctcggaggcg
caacgagaagatcatccggacggtccggtattgcaagcaatgccctccgaacaaatacgc
tgccaattggtaaacatggcgaccgtgttacaccgtgccattaatgtgataaatcctaac
aaaaagaaattcgaacgcgagaaagtacgcaatgtattggttgctcactatcatgaaact
aagatcaaggatcatcagaaaatattaggcaggcacaaaattatcgaggagcgaaaggaa
tatatcgagcacatcaatacggtccgcgaagaggaggagatgcgtcgacaggaggaactt
caacggcaacaaatgttggctgaacagaagcgactggaacaggaacgggaggagcgcgaa
cgaaagcgtcagcaaagcgagattcagcagatcaaggatcgccatctcaaagaaaagatg
cagcagatttcacagacaagtcacgggcaaaaggtgctgaagaaactagatgaggatgaa
attaaaaaactggacgcggaacaaattgcggcgcgggaagctgaagagctacagaaagag
cgcagagaaatgcaacagaagctcaagtcccaggaaaagaaagtcgattatctggagcgt
gctaaacgactcgaggagattccactgctggagaaggccgtgcaggacaggatgcaacaa
gcgaaacaactctggcggcaacaggaagatgagcgaattgccgcagctatcgaagagaga
caggaggctgtcgcgactcaagagcgcttagcgcgtatgaaagaagatcacggcattttc
ttagctaagatcttagctgagcgtagaaacatatacacagaaaaactgaaggaatttgag
aaattattgaacgaggagcgcgttaagcgattattgaagcgcaaaatggatcgtaaagcc
gagcgtaaggcgaaatgggagaaggagcgtgcggaagctgcagaacgaagacgattggaa
gaattgcgtatcaaacaagaagaggaaaagaaacgtcttgaagaggaaagagctaagaga
gaggaggaggagagaatcagacgagttgaagaggaagccagagaagccgaacgtatggct
aagcttaagaaacaagctgagattattagagctaaggaagctgaaattgaacgtaaattg
gaggaagaacgattgagagataaagaactgacttcaacatggcggcgtggtatggataat
gatcgtgatcgcgatcgtgatcgtgatcgtgatcgtgatcgcgatcgtgaacgtgaacgt
gaccgtgatcgcgatcgtgatcgtgatcgtgaccgtgaacgcgatcgcgatggtccgaaa
ccttcgatggagtcatggcgacgtaatcctgacaaagactctgatggactcaaaaacgac
acagatcgctggaggaaacgcgatgacaagattgaggattcttcatggaagagaagggaa
ccagaaagagaaccacgtcgtgatatggacaaatggagaagaaacgatgactcggaccga
tggaagaaggatactatggaaaaatggaggaaagatgataattacgatagagaagattta
agagatcgagataggctagacaaccgtggtttcgacaagagagatgatcgtgatcgtgac
cgtgaccgtgaccgtgaccgtgagcgtggaatagaaggacgtggaatacgcgagattcca
cgtgacacaatacgcgatgatcgagatagagatcgtgatcgtgatcgtgatcgtgatcgt
ggtagaatgtccgatcgccgtggtggttaccgcgatcgtcgtgatgaaccagcacggcca
aatactaatcaggactggcggaaacgcgacccgcctcaagattccccaagagacccaccc
aagcgcgaacgagaggatcgtaaagatgacagacttccgcctagatctgacgagagaagg
cgaccattagaggatgatggttggtcgaaagttagtcggcgctga

DBGET integrated database retrieval system