KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105147915Help
Entry
105147915         CDS       T03917                                 

Definition
(RefSeq) dual specificity protein phosphatase 10-like
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec04013  MAPK signaling pathway - fly
aec04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:aec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105147915
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105147915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aec01009]
    105147915
Enzymes [BR:aec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105147915
    3.1.3.48  protein-tyrosine-phosphatase
     105147915
Protein phosphatases and associated proteins [BR:aec01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    105147915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase PTPlike_phytase Init_tRNA_PT Sporozoite_P67 Myotub-related Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 105147915
NCBI-ProteinID: XP_011057589
Position
Unknown
AA seq 498 aa AA seqDB search
MTRSLSEPGPSPCAFPAPTTTSSIINNNNSNNNSTEPPSIVINEEVNGDEDDDVHRRGFH
HLHYHHHHHHHHFHHHQHLSVTTKRCKLETASLPTSPCSENGLHRQLVLSKTRVITADDL
AQRLVHLERSSAVPVILDCRPFTLYNVNHVRGAINVTCSDRFNRRRLQLGKATLADLASA
REGKELLRKRQFKEVIVYDEGTDDLEHLTAQNPLFLVLAALVDDDREPAVLIGGHREFHR
RHRELCEDTLLPNGAAAAAAAAAVAADPSTTTVSGCTSPGPGCPVLSISGPPTPQPADID
NHPASRVLPFLYLGNGDLQLLRALGATRVLNVTSQLPGYHEERGITYRQIPASDSGHQNL
KQYFEEAFEFIEEARKAGSSVLVHCQAGVSRSATIAIAYIMRHKGLSMVEAYKLVKNARP
IISPNLNFMGQLLELEQGLRASGDVANSAPEEPTTTMVTSTTTTSTSTTATTTTSSCHQC
RWSHQPNSEEVVTSGCSV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcagcctgagcgaaccaggaccgagtccctgcgccttcccagcaccaacgacc
acttcgtcgatcattaataataacaacagcaacaacaattctaccgaaccgccttcgatc
gtgatcaacgaggaggtgaacggcgacgaagacgacgacgtccaccgtcgtggcttccat
catctccattaccatcaccatcatcatcaccatcattttcaccatcatcagcacctatcg
gtgactacaaagcgctgcaaactggagactgccagcctgcctaccagcccctgctccgag
aacggccttcatcgccaattagtgctaagcaagactcgcgtcatcaccgcagacgacctt
gcccaacgtcttgtgcatcttgagcgatcctccgccgttccagtgattctggattgcaga
ccgtttacattatacaatgtcaatcacgtacgcggtgccatcaacgtcacttgttcggat
cgcttcaatcgacgcagacttcagctgggaaaggccaccctcgccgatctcgcatccgct
cgcgagggcaaagagctgctcagaaaaagacagttcaaggaagtcatagtgtacgacgaa
ggtaccgacgatctggagcatctgaccgctcagaatccactattcctggtacttgctgca
ctcgtggatgacgatcgggagccggctgtgctgatcggtgggcaccgggagttccacagg
cggcaccgagagctatgcgaggatacgcttctgccaaacggcgccgccgccgctgccgct
gctgccgccgttgctgcagatccgtcgacgacgacggtgagcggctgcacgagtcctgga
ccaggttgtcccgtgctgagcatctctggcccgccgaccccgcagccagccgacatcgac
aaccacccggcgtcccgcgttctgccgtttctgtacctcggtaacggcgatctgcagcta
ttgcgcgccctcggcgccacccgggtgctgaacgtcacctcacagctgcccggctaccac
gaggagcggggtatcacgtacaggcagatacccgcctcggactccggccatcagaacctc
aagcagtacttcgaggaagcgttcgaattcatcgaggaagcacggaaagccggaagcagc
gtattggtgcactgtcaagctggtgtgtcgcgcagcgcaacaattgcgattgcttacata
atgcgacacaaaggcctgtcgatggtggaggcgtacaaactggtgaagaacgcgcgcccg
atcatcagtccgaacctgaacttcatgggtcagctgttagagctcgagcagggtctgcgg
gcgtccggtgacgtcgccaactctgcgccagaggagcccacgacgacgatggtaacgtca
acgacaacgacgtcgacgtcgacaacggcgacgacgacgacgagtagttgtcaccagtgc
aggtggagtcatcagcctaacagcgaggaggtggtcacctctggctgcagtgtctga

DBGET integrated database retrieval system