KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105148021Help
Entry
105148021         CDS       T03917                                 

Definition
(RefSeq) N6-adenosine-methyltransferase subunit METTL3 isoform X1
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aec03019]
    105148021
Enzymes [BR:aec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     105148021
Messenger RNA biogenesis [BR:aec03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     105148021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 105148021
NCBI-ProteinID: XP_011057769
UniProt: F4WQT2
Position
Unknown
AA seq 548 aa AA seqDB search
MSDAFEEIQAIKIKRNSYREKLQKRKRERHELYTLTSTPASSTLTAESACPDSNASSRSD
HSEYERDVLCILHESLPNLPITSADLIDQLRKNLNADVSSSDIHKILEKLAAQDIVKIKE
VTENGVFGYTVLSVTESQSSCQSQSDDTENAESIEMSMSELNDHVPPEKQAKVDKKNTED
IMSLISMPTIREKESKKVGEQILDLLSKQTSKEKSLAERFRSQGGAQVMEFCPHGTKVDC
MKLNGGPGFAEKCKKLHFKKIIQSHTDESLGDCSFLNTCFHMDTCKYVHYEVDGPTAQLK
EINDSDSSSNTTSNKTLNLDSKNGSSSSSNVGSELTLYPPQWIQCDLRYLDMTVLGKFAV
IMADPPWDIHMELPYGTMSDDEMRQLGIPALQDEGLLFLWVTGRAMELGRECLQLWGYER
VDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGMKGNPRINRGLDSDVIVAEVRATSH
KPDEIYGIIERMSPGTRKIELFGRPHNVQPNWITLGNQVDGVHLIDPQLIKAFKKRYPDG
NSMKPTKP
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgcttttgaagaaatacaagcgattaagataaagagaaacagttatcgtgag
aaactacagaagaggaaacgtgagagacatgaattgtataccctcacttctacgccggct
tcatccaccctgacagcagagtcggcgtgtcctgattctaatgcatcttcacgttcggat
cacagtgaatatgaaagagacgtactttgtatcttacacgagtccttacctaatctaccg
ataacatccgcagacttgatagaccagctacgtaaaaatcttaatgccgatgtatcttct
tcagatatccacaagattctggagaagctggctgcacaagatatagttaagatcaaagaa
gttacagagaatggagtatttggatatacagtgttgtcggtaacagaatcccaatcgtca
tgtcaatctcagtctgatgacacagagaatgccgaaagcatagaaatgtctatgtctgaa
ttaaatgaccatgtgcctccagagaaacaagcgaaagttgacaagaaaaataccgaggat
atcatgtctctaatttcgatgccgacgattagagaaaaggagagcaagaaggtcggtgaa
cagatcctggatctactgtcaaagcagacttccaaagagaaatcgctggcagaacgattt
cgctctcagggaggagctcaagttatggaattctgtccacatggtacaaaagtagactgt
atgaaattgaatggtggtccgggattcgcggaaaaatgtaaaaagctgcattttaaaaag
atcatacagagtcatacagatgaatctttgggagattgtagttttctcaatacctgcttc
cacatggacacatgcaaatatgttcattatgaggtagatggtcctacggcacaactaaaa
gaaatcaatgactccgatagttcgagcaataccacatctaacaagacgttgaatctagat
agcaaaaatggtagcagtagcagtagcaacgtaggtagtgagttaactctgtatccacca
cagtggattcagtgtgatttgcgttacctcgatatgactgttcttggcaagtttgctgtg
atcatggccgatccaccatgggacattcatatggagttaccttatggcactatgtcagac
gatgagatgagacaattgggaatcccagcacttcaagatgaaggactcttgtttctttgg
gtgactggcagagctatggagctgggaagagagtgtctgcagctatggggttatgagagg
gttgacgaaatcatctgggtgaagactaatcaattgcaaaggataatacggactggtagg
acaggtcattggctaaatcatggcaaggaacattgtctggtcggcatgaagggtaatcct
cgtattaatcgaggattggacagtgatgtgattgtcgctgaggttcgtgctactagtcac
aaacccgacgagatctacggcatcatcgagcgaatgagtcccggtaccagaaaaattgaa
ttatttggtcggccgcataatgtacaacccaactggattacgttaggcaaccaggtggat
ggtgttcatctaattgatccgcaacttattaaggcctttaaaaaacgttatcccgacgga
aactcgatgaagcctaccaagccataa

DBGET integrated database retrieval system