KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105149911Help
Entry
105149911         CDS       T03917                                 

Definition
(RefSeq) probable glutamate--tRNA ligase, mitochondrial
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00860  Porphyrin and chlorophyll metabolism
aec00970  Aminoacyl-tRNA biosynthesis
aec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    105149911
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105149911
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aec01007]
    105149911
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aec03016]
    105149911
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:aec02048]
    105149911
Enzymes [BR:aec01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     105149911
Amino acid related enzymes [BR:aec01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   105149911
Transfer RNA biogenesis [BR:aec03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    105149911
 Prokaryotic Type
   Other AARSs
    105149911
Prokaryotic defense system [BR:aec02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    105149911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-GeneID: 105149911
NCBI-ProteinID: XP_011060954
UniProt: F4WW98
Position
Unknown
AA seq 510 aa AA seqDB search
MQRSILRATSLQLLQRRFFKKYHVRVRFAPSPTGHLHLGGLRTALYNYLFARSNNGTFIL
RIEDTDQTRTIPGAIEKIQDDLLWAGIISDEDPTRGGPVSPYIQSSRLELYKEQVLKLLN
NGSAYYCFCTEKRLDLLRKEAMKCGQIPKYDNRCRHFTKDEVKEMIKKNLTYCIRFKLSS
TPETFHDLVYGDVLHDITKSEGDPVIIKSDGYPTYHFANVVDDHFMEISHVLRGVEWQVS
TSKHIMLYKAFGWNPPIYGHLPLIMNADGSKLSKRQGDIKIDSFRKQGIFPLALLNYVIG
AGGGFHREQDNQDLYSYEELIKQFDITKIKLSSGKLMPEKLLEFNKLEMANLLRNEKNHK
FFIEKIKKLVLKTFPEWKNDGNLQLDDDHIITTFKWAQNRITTLNDLVKEDLAFLWIVPS
SMPNVKQDGCSDAIKLLNAELVEIDASNYKTDWMAPYLKDFAKKNGVPFAAFMKTLRSVM
SGVNIGPPVAEMMEILGKDRTLLRLQRCVS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtagtatactccgcgcgacaagtctccagttgttgcaaagacgcttctttaag
aaataccacgtgagggttagatttgcgcccagccctaccggccacttgcatttaggagga
ttgcgcacggcgttgtacaattatttatttgcacgtagcaacaatggcacatttattttg
aggatcgaggacaccgatcaaacaaggacaattcctggagcaatagaaaaaatccaggat
gatttgctatgggcagggattatatctgatgaagatcctaccagaggaggccctgttagt
ccttatatacaatcgtcaaggcttgaattatataaggagcaggtgcttaaactcttgaac
aatggatctgcttactattgcttctgcacagagaaaagactggacctgctgaggaaagag
gcaatgaaatgtggacaaatacctaaatacgataacagatgccgacattttactaaggat
gaagtaaaagaaatgattaagaaaaacttgacttattgtattagatttaagttatcatcc
acaccagaaacctttcatgatctagtttatggagatgtcttgcatgatatcactaaatct
gagggagatccagttatcataaaatcagatggttatcctacttaccattttgcaaacgta
gtcgatgatcactttatggagatatctcatgtcttacgtggtgttgaatggcaagtttct
acatctaaacatattatgctttacaaagcatttggttggaatcctcctatatacggacat
ttacctttgataatgaatgcagatggatctaaattatcaaaaagacaaggtgacataaaa
atcgactcattccggaaacaaggtatttttccactagcattattgaattatgtgatagga
gctggtggtggttttcacagagaacaagacaaccaagatctttattcttatgaggaatta
attaaacagtttgatattacaaaaataaaactaagttctggcaaacttatgcctgagaaa
ttattggaatttaataaactggaaatggcgaatttactacgaaatgaaaaaaatcataaa
ttttttattgaaaaaattaagaaattagtgttaaaaactttccccgaatggaaaaatgat
ggaaatttgcaattagatgatgatcacataataacaacatttaaatgggcacaaaacagg
ataacgacacttaatgatctcgtcaaagaagatttagcatttttatggattgttccatct
tctatgccaaatgttaaacaagatggatgttcagatgcgattaaactattgaacgcggaa
ttagtggaaatagatgcgagtaattacaagaccgattggatggcaccttatctaaaagat
tttgccaaaaagaacggagtaccattcgctgcttttatgaaaactctgagaagcgttatg
agcggcgtaaatattggaccacctgttgctgaaatgatggaaattttgggaaaggataga
acgttattgcgattacagcgttgtgtttcttga

DBGET integrated database retrieval system