KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105150711Help
Entry
105150711         CDS       T03917                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aec04131]
    105150711
Membrane trafficking [BR:aec04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    105150711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N AAA_25
Motif
Other DBs
NCBI-GeneID: 105150711
NCBI-ProteinID: XP_011062268
Position
Unknown
AA seq 1988 aa AA seqDB search
MSSVQRAFAHKLSKQHAADVRRQIATSTSYSRDLSKSGSSISGFSSTMSLCEVLEPLDYE
EFLGQHQSVLDRDPLKPILDFPLGDVELRVVKRKIRTEESVVPHESIDTVSPYVKRCIES
FTSDWIVIHRKYKGRISPIARDRLLQDTPRQDFEVDQEDANGCVSPNEEDDLSNSGDTPR
GSWASLDLRHSQHDPLLPTLLDRVCLETIDQMNEQKRLEDRQEALFPLYAPPTSPDDEWQ
EINVAPEPTEPFAHKILVKCLQLKLELEVEPIFASLALYDAREKKKVSENFYVDMNSEGL
KRMLGGHIAYSDASTLARSCVLSISKPSPDLFLVVRLEKVLQGDISECAEPYLREDKNKD
KVRAAAAAACERLGRYRMPLAWTAIHLSGVIGGGGDTDSTGSAGSLDRKSGGLEQWRKKV
EPPTRRGSLERRSSDKRRSWSPDDFANCLDNFRPITLTVSSFFKQESERLRDEDLYKLLV
ELRRPGSNLKRLKCLPGILKLDLSPRPEELPRCLDPDLRRLVPYPDEKSRPVKEILEFPS
EVVSPDLTYRNLLYLYPKEANFSSRTGSARNIAVRIQLMGGEQEADALTAIFGRSSCPEM
THEYFTSVSYHNKNPNFYDEIKMRLPADLSAKHHLLFTFYHISCQKKMEQPNVETAVAYT
WLPLLRDGHLQSGEFSLPAMLDPPPANYSYIAPDVLLPGTRWVDAHRGVFTVILEPVSSV
HPQDKYIDRFLSLCGFLETGQVPPRIGEAGMESELKSALLELARGSHSALVRSLPQLLDQ
LLCLLVRPPTLPSQSLNVAATIFEALGLLVRNITNLPDGQLDAHGRHALLATYIAYQCSL
PSMTHIGSVARAQSNPDLPLEDLEMEIHSRGLDRTASMRQESPSINSHPTRRLLHEELAL
HWVVSTGQARELAITHSWFFLELIMRSMVVTMSEMGSLEALRKLRFSPQFCDDVATLTAA
LTSEVISRCGKEIRVASNLISSLGNFLSDLLSVMDRGFVLSLVRAACCSLSDASMHIPDS
AALFALKLDLVRTVCSHEHYVALNLPFGTGYTSGSAPASPSPSTGSSGSLISTLVPGDRA
RFSELSQEFRQQHFLVGIVLSDLANTLEIPNPMLQNKAIGTVRHLMSCHDADPRYSDPAA
KARVAALYLPLLSILMDALPQLYHWDSKDKSVYPDESGSITQSVALAIAGGVSADTAGNQ
CRVSLSSEATRHLLMCVLWVLKGLERTALAQWCSELSARRILSLLQVLNIATAAFEYKGK
KALKRLPPQATATSDIRSRLEDVILGQGSARSEMMLRRKERVTGDKLRWRKDQMPYRSCE
QPEGRAVEQDAHIEGALAAEASLVVLDTLESVVQADGGGGAVVGAVLKVLLRALARNQST
LVLQHMFNTQRALVFKYHSALFDEESERCGDLCLTLLTRCSSPLSAIRSHAAASLYLLMR
QNFEIGNNFARVKMQVTTSLSALVGRGRAPSEGALRRALKTVLVYAERDTELADTSFPEQ
VKDLLFNLHMILSDTVKMKEFQEDPEMLLDLMYRIAKGYQGSPDLRLTWLANMAQQHMER
KNHTEAAMCLVHSAALVAEYLHLLEPGGGGRPVGAVALNAVTPNALEESAVGDDVLARRE
EGLCLGPDFSESGLAGLLEHAASSFHAAGMYEAIPDVYRVLLPIAEAAHDYKKLANIHGK
LHEAYTRVEQLAGKRVFGTYFRVGFYGARFGDLAGEEFVYKEPTLTKLPEIFSRLENFYA
ERFGADNIVIIKDSNPVDPSKLEPDKAYVQITYVEPYFEAHELRHRPTVFHRNFNIKRFV
YATPFTPGGKAHGELREQCKRKTILTVATHFPYLKTRIRVVARKQIVLSPIEVAIEDIQK
KTAEVAAATVQEPPDAKMLQMVLQGCIGTTVNQGPAEVAVVFLSGLREQNAQPSRLQHKL
RLCFKDFQKKCLDALRRNKNLIGPDQRDYQRELERNYQRLTERLAPLIAWSGPSLINQQA
VPSTPPRW
NT seq 5967 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagtccagcgtgcatttgctcacaaattaagcaaacaacatgctgctgatgta
aggcggcaaattgctacttctacttcctattcccgtgatttatccaaaagtggtagcagt
atatcaggattttcttctacgatgtcgttgtgcgaggtattagaaccacttgattatgaa
gaattcttgggacaacaccagtcagtgttagaccgtgatcctttaaaaccaatattagat
tttcctctgggagatgttgaattgagagttgtaaagaggaaaattcgaacagaggagtca
gtagtaccacatgaatcaatagataccgtgtcaccttatgtgaaaagatgcattgaaagt
tttacttcagactggattgtaatacatcgcaaatataaaggaagaatttcacctattgcc
agagacagattacttcaggatacacctagacaagattttgaggtagatcaagaagatgca
aatggctgtgtatcaccgaatgaggaggatgatttgtccaattccggagatactccaaga
ggatcttgggcaagtttggatttgcgacattcacaacatgatcctcttctgccaacttta
ttagatcgcgtctgccttgaaacaattgatcaaatgaacgaacaaaaaagattagaagat
cgacaggaagccttatttcctctttatgctcctccaacttctcctgatgatgaatggcaa
gaaattaatgttgctccagaacctacagaaccttttgctcataaaattctcgtgaaatgt
ctgcaattaaaattagaattagaagtggagccaatatttgcgagccttgcattatacgat
gccagagaaaagaaaaaagtatcggagaatttctacgtcgatatgaattcagaagggtta
aaaagaatgcttggaggacacattgcttacagcgatgcaagtactttagccagaagctgt
gttttgagtatcagcaaacccagtcctgatttgtttcttgtcgtacggctagagaaagta
ctgcaaggtgatatatcggagtgtgccgaaccatatctacgtgaagataaaaataaagat
aaagtcagagctgccgctgccgctgcatgtgaacgccttggtcgttatagaatgcctctc
gcatggactgcaattcatctgtctggtgtaattggtggtggtggtgacacggatagcact
ggcagcgctggatccttagacagaaaatcaggaggtctggaacagtggcgaaagaaagtg
gaaccaccgacgcgacgaggttcgctagaaagacggagttcagacaaaagacgcagttgg
tcaccagatgattttgccaattgtctcgataattttaggcccattaccttaacagtttcg
agctttttcaaacaggaaagcgaacgacttcgcgatgaagatctttataaacttttggtt
gaattacgaagacctggatctaacttgaaacgattaaaatgcttaccagggatattgaaa
ttggatctcagtcccagacccgaagagctgccgaggtgtctcgatcctgatcttaggaga
ttagttccatatccggatgaaaagagtcgacctgttaaggagatactcgagtttccgagc
gaagttgtttcgccagatttaacatatcgtaatctcctttatctttatcctaaggaagca
aactttagttctagaactggctcagctcgcaatattgctgtaagaattcagcttatggga
ggtgagcaagaagccgatgcgctcacagctatctttggtagatcatcatgtcccgagatg
acgcacgagtatttcacttccgtgtcatatcacaacaagaatccaaatttttatgatgaa
atcaagatgaggctacccgcggatttaagtgcgaaacatcacttattgttcactttttat
cacattagttgtcagaagaaaatggaacaaccaaacgtcgaaacggcagtcgcatataca
tggctaccgcttttaagagatggtcatctccaatcaggcgaattcagtttgcctgctatg
ctggatccaccacccgcaaattattcctatattgctcctgatgttcttttaccaggcact
cgatgggtagatgctcacagaggagtcttcactgtcatattggagcctgtttccagcgtt
catccgcaagacaaatatatcgacagatttttatcgttgtgtggatttttggaaaccggt
caagttccgcctcgtataggcgaagcgggcatggaatcagaattgaaatcggcgctcctc
gaattagctcgcggctcgcattctgctttggtacgatctcttcctcaattactggatcaa
ttactgtgtcttctggtgcgaccgccaaccttaccatctcaatcattgaacgtcgccgct
accatttttgaggctttaggattgcttgtgcgaaatatcaccaatttaccggacggtcaa
ctggatgcacatggaagacatgctcttttggccacttacatagcatatcaatgctctcta
ccgagcatgactcacatcgggagcgttgcacgagcacagagcaatcccgatttgcctttg
gaagatctggagatggagatccattcacgaggattggacagaactgcgtcgatgcggcag
gaatctccctcaatcaatagtcatcccaccagaagacttctacatgaggaacttgctttg
cactgggttgtatccaccggtcaggcacgcgagctggcgataactcattcctggttcttc
ttagagttgataatgcgttcgatggttgtgacgatgtccgaaatgggatccttagaggca
ttgcgaaaattgagattttcaccacaattttgtgatgacgtcgctacactcactgccgcg
ttaacatccgaggtgatatctcgttgcggcaaggagattcgcgtggcatccaatttaata
tcgagtcttggcaattttttgtctgatctgttatctgtaatggatagaggatttgtattg
tcactcgttcgcgccgcctgttgttcgctgtcggatgcgtcaatgcatattcctgattcg
gcggcattgttcgctctgaaactcgatctcgtgagaacggtgtgctcgcacgagcattac
gtagcattgaaccttcccttcggcactggctatacatcaggatccgccccggcatcaccc
agtccatcaaccggcagctcaggcagtttgatatccactctcgtgcccggtgatagagct
cgcttttcggaactcagtcaagaattcaggcagcagcattttctggtcggcattgttctg
tctgatctggcaaatactttggagataccaaatccgatgctacagaataaagctatcgga
actgttcgacatcttatgagttgccatgacgctgatccacgatattctgatcctgcagcg
aaggccagagtcgctgcactatatctaccattacttagtatcttgatggatgccttaccc
cagctttatcattgggattccaaagataaaagcgtttatccggatgaatccggatcaatc
acgcaatcggtagcattggccattgcaggcggagtatcggcggatactgcgggcaatcag
tgccgcgtatccttgagttccgaagctactcgacatttattaatgtgtgtcttatgggtg
ctcaagggattggagcgaactgctctagcacaatggtgctccgaactcagtgcgagacgc
atattgagcttgctgcaagtattgaatatagccactgcagcatttgagtacaaaggcaaa
aaagctcttaaaagattgccacctcaagcaacggccactagtgatattagatcgcgattg
gaagacgtgattcttggtcagggaagtgctaggagcgaaatgatgctgcgaagaaaagag
agagtgaccggagataaattgagatggcgcaaagatcaaatgccttatagatcttgcgaa
caaccggagggaagagctgtggaacaagacgcccatatagaaggagccttagcggctgag
gcttctcttgtcgtattagatactttagaatctgtagttcaagctgatggcggtggaggt
gcagttgttggtgcggtattgaaagtgttattaagagctctggctagaaatcaaagtaca
ttggttcttcagcacatgttcaatacacagcgagctctagtcttcaagtatcatagtgca
ttgttcgatgaggaaagcgagcgctgtggggatttgtgtttaacactgctcactcggtgc
agctcacctttaagcgctattagaagtcacgcagctgcgagtttgtatttactgatgcga
caaaatttcgaaattgggaataattttgcgcgcgtcaagatgcaagtcacaacatcgtta
tccgctcttgttgggagaggaagagctcctagcgaaggagcgttacgtagagccttgaaa
acagtgctggtatacgccgagagagatacagagcttgcagacacgagttttcctgaacaa
gtgaaggatctactattcaatcttcatatgattctttctgatactgttaagatgaaagaa
ttccaagaagatcctgaaatgctcttggatctaatgtatagaatcgccaagggttatcaa
ggatcacctgatcttcgtctgacttggctcgcaaacatggcacagcagcacatggaaagg
aaaaatcacacagaagcagcaatgtgtttagtgcatagtgccgctctggtagcggaatat
cttcatttgttagaacctggtggcggtggtcggcctgtaggagccgtcgctttgaatgct
gtgacaccgaatgctttagaagaaagcgctgtcggcgatgacgtattagctagaagggaa
gaaggactttgcttaggccctgatttttcagaaagcggattggcaggtttattagagcac
gcggctagctcttttcatgcagctggaatgtacgaagctattcctgacgtctatagggtg
ttgttacctatagcggaagctgcacacgactacaaaaaattagctaatattcacggtaaa
cttcacgaggcatatacgcgtgtggaacaattggccggcaaacgtgtctttggaacatac
tttagagttggtttctacggcgccagattcggtgatctcgctggcgaagaatttgtttac
aaagagcccaccttgacgaaactcccggagatattctcgagactcgagaacttttatgcc
gaaagattcggcgcggataatatagttataataaaggattcaaatcctgtggatcctagc
aagctggaaccagataaagcttatgtacagatcacttatgtagaaccatattttgaagcg
cacgagcttagacacagaccaacagtttttcatcgaaatttcaatataaaacgattcgtt
tatgcgacaccttttactcctggtggcaaagcacacggcgagttacgcgaacaatgtaaa
cggaagactatattaacagtggcaacacatttcccgtatttgaaaaccagaattcgagtc
gtagctcgaaaacagatagtcctaagtcccattgaagtagcaattgaagacatacagaag
aagactgccgaagtggccgctgcgaccgttcaagaaccacccgatgcaaagatgctgcaa
atggtccttcaaggttgcattgggacgacggtcaatcaaggacctgctgaagtagcggtc
gtatttctttctggtttacgcgaacaaaatgcgcaaccgagcagactgcaacacaagctt
cgtttgtgtttcaaagatttccaaaaaaaatgtctcgatgctttgcggcgtaacaagaat
ttgattggtcccgatcagcgggattatcagcgggaattggagagaaattatcaaagatta
actgaaagattggcacctctcattgcttggagcggaccatctttaattaatcagcaagct
gtaccatcaactcctccacgctggtaa

DBGET integrated database retrieval system