KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105151815Help
Entry
105151815         CDS       T03917                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00511  Other glycan degradation
aec00600  Sphingolipid metabolism
aec01100  Metabolic pathways
aec04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    105151815
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    105151815
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105151815
Enzymes [BR:aec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     105151815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C HP1451_C
Motif
Other DBs
NCBI-GeneID: 105151815
NCBI-ProteinID: XP_011064043
Position
Unknown
AA seq 510 aa AA seqDB search
MLRTLILIAVLITVKGDECIPRSFGNNSIVCVCNSTYCDTVSKQKLQQNQLLWYTSTQDG
KRMQSSIMNFSAKNESEIDLVLTVDINQKFQKIQGFGGAMTDAAALNIKSLSNNTQQILL
ESYFGSKGIGYTFTRIPIAGTDFSMRPYTYDDVPDDLMLSHFGLVEEDDYKIKYLHNIKK
IMSNPDEFRILTTAWSAPAWMKSSKSITWGILKSEYYQLYADYIVKFFDAYKERGINIWG
ITPGNEPLNGFIPFFTFNSMGWTPNTSAVWTVKHLAPTLTNAGYNPLYIAMDDQRFEIPW
FTELMFEYPKTKELFSGTAVHWYADEIFSPIRLSQLHDKYPDKFILMSEACTGSSPFNKE
KVILGSWKRGQKYALNIIENLSHWMVGWIDWNMALDEYGAPNWAKNYVDSPIIVMPQTDE
FYKQPMFYAISHFSQFVPRNSYRILSTGLEDNPNIKTIAFLTPENCITVVAVNKAYTPST
ITIKNKNKNNVVNVCLPAKSFNTLLYLAQE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcacgttaattttgattgctgtcttgatcacagtgaaaggagacgaatgtata
ccacgttcattcgggaacaattctatagtatgcgtctgtaactcgacgtattgcgataca
gtaagcaagcaaaaattacaacagaaccagcttttatggtacacatccactcaagatggc
aaaagaatgcaatcgtccattatgaatttctccgccaaaaatgaatctgaaatcgatctg
gttctcacagtggatattaatcagaaatttcaaaagatacaaggatttggcggagcaatg
accgacgccgctgcactcaacattaaaagtcttagtaataacactcaacaaatactactt
gagtcgtattttggttccaagggtatcggatacacatttactcgtatacctatcgcaggt
accgatttctcaatgagaccatatacatacgacgacgtacccgatgatcttatgttaagt
catttcggacttgtggaggaagatgattacaaaatcaaatatctacataatatcaaaaaa
attatgtctaatccagatgaatttagaatcttaacgactgcatggagcgcgcctgcgtgg
atgaaaagttctaaaagtataacttggggtattttaaaatctgaatattatcaactttac
gctgattatatcgtaaagttctttgacgcatataaggaacgtggtataaatatatggggc
ataacacctggcaatgaaccattaaatggatttataccattcttcactttcaattccatg
ggttggacgcctaacacttctgcggtttggaccgtgaaacatttagctccgactttgact
aatgctggatataatcctctctacatagcgatggacgatcaacgcttcgaaatcccgtgg
tttaccgagttgatgtttgagtatccaaaaactaaagaactgttctctggcactgcggtc
cattggtacgctgatgaaatattttcaccgattagactgtctcaattgcatgataaatat
ccagacaagtttatactgatgtccgaagcatgcaccggtagcagtccctttaacaaagaa
aaagtaatattaggatcatggaaacgaggacaaaaatatgccttaaatataatcgagaat
ttatcacattggatggttggatggatagattggaatatggcactcgatgagtatggagca
ccaaactgggcaaaaaattatgtggattcaccaatcatcgtaatgccgcaaacagacgaa
ttctacaagcagcctatgttttacgcaatttctcacttcagccaatttgtgccgcgtaat
tcttacaggattttatctacgggtcttgaagacaatccaaacattaaaacaatagcgttt
ttgacgcccgaaaattgtattactgtcgtggctgttaacaaagcttacactccttccact
ataacaataaaaaataagaataaaaataacgtagtaaatgtatgcttacctgccaagtct
ttcaatacattgttgtatttggcgcaagaataa

DBGET integrated database retrieval system