KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105151906Help
Entry
105151906         CDS       T03917                                 

Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec04136  Autophagy - other
aec04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:aec00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105151906
   04136 Autophagy - other
    105151906
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aec04131]
    105151906
   03029 Mitochondrial biogenesis [BR:aec03029]
    105151906
Membrane trafficking [BR:aec04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    105151906
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    105151906
Mitochondrial biogenesis [BR:aec03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    105151906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Ge1_WD40 Cluap1 Cytochrom_D1 DUF2854 ApoLp-III
Motif
Other DBs
NCBI-GeneID: 105151906
NCBI-ProteinID: XP_011064185
Position
Unknown
AA seq 568 aa AA seqDB search
MTSNEAAVSLGVAREDINWRKDLISQLRERNRSQTNCFADLISLHNRLFENTNTLRNSNM
QLTIANETLRREAANGGIGMGGNPDLEARLLKQAEELAMLHKRKGEHTQQIVDLNNKLQE
MTKELHGKEASLGESLEANINLRLEITKCLAREKDLEGINQMLKDEHQALQLAFASLEEK
LRKTQEENRQLIERLIKYKARDAEKMNEENDNFLSFTSPTTFLMHTLSKFGKRQAKMQKE
LEDAARDTRPVSPDRLSLKEVAGLPTAVPTKVSVTFSAHEGEVFAVKWSPTDRILATGGT
DRKVKLWNINKDTSENKGILVGSNAGVMSVDFDSTGTLILGASNDYASRVWTVNDLRLKH
TLTGHCAKVMAAKFLGEPSKVVTGSYDRTLKIWDLRSKACIETKFAGSSCNDLVTSDGAG
STIISGHFDQRIRFWDTRAESSSNDILLEGKVTSLDLSRDANYLLSCVRDDTVKLIDLRM
KKIVGSFSADGFKVGFDWTRAVFSPDGQYIAVGSADGSVFIWSIATNAIETILKEHTAGV
TAVSWHPHGTYLASVDRAKTVTVWGDHV
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaacgaagcagccgtgtcgctcggtgttgcccgagaagacatcaactggcgg
aaagatttgatttcgcaattacgcgaaagaaacagatcgcaaaccaattgttttgcagat
ctcattagcctacacaatagattatttgaaaatacaaatacattgcgaaattcaaatatg
caattgacaattgcaaatgagactcttcgtcgcgaagcagccaatggtggtattggcatg
ggtggaaatcccgatctcgaagctagacttttaaagcaagcggaagaattggcaatgctg
cataaaaggaaaggagaacatacgcaacaaatagtagatctcaataacaaattgcaggaa
atgacaaaagaacttcatggaaaagaagctagtcttggagaaagtttggaagctaatatt
aacttacgtttagaaataactaaatgccttgctagagagaaagatttagaaggcattaat
cagatgctcaaggatgaacaccaagccttgcaacttgcttttgcatctttagaagaaaag
cttagaaaaacacaggaagaaaatcgacagctaatcgagcgtttaataaaatataaagcc
agagatgcggaaaagatgaatgaagaaaatgataactttttaagttttacgagcccaaca
acctttttgatgcataccttatcaaaatttgggaagagacaagcaaagatgcaaaaggaa
ttggaagatgcagcacgagatacgcgacctgttagtccggatcgtttaagcttaaaagaa
gttgctggtcttccgacagcagtgccaacgaaagtatccgtaacatttagtgcccatgag
ggagaggtattcgctgttaaatggtcgcctactgatagaatattggctactggaggtact
gacaggaaggtgaagctttggaacattaataaagatacatcggaaaacaagggcatcctc
gttggcagtaacgctggtgtgatgtcggtggactttgattcaacaggcacgcttattctt
ggagcatccaacgattatgcgagccgcgtctggaccgtcaatgatcttcgcctaaagcat
acactcacgggccactgcgcaaaggtgatggcagcaaagtttcttggcgaaccgtcgaaa
gtagttacgggaagttatgatcggactttaaaaatctgggatctgcgcagcaaagcatgt
atagaaacgaaattcgccggttcgagttgtaatgatctcgtaacttccgacggagctggt
tccacgataatcagtggtcattttgatcaaaggatcagattttgggatactagagccgaa
tccagttcaaatgacattctattggaaggaaaagttacatctttggatttatctcgcgac
gcaaattaccttttgagctgcgtgagggatgacacggtgaaactgattgatttacgaatg
aagaagattgtcggatcgttcagcgctgacggttttaaagtgggattcgattggacaaga
gctgttttcagtcctgacggacagtacatagcggttggttccgccgatggttccgttttc
atctggtctatagcgacgaatgcgatcgaaacaatactgaaagagcatacggcaggagta
acggccgtgtcttggcatccacacggtacgtacttagcatctgtcgatcgtgccaagacg
gtgactgtttggggcgaccacgtttga

DBGET integrated database retrieval system