KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105152625Help
Entry
105152625         CDS       T03917                                 

Definition
(RefSeq) serine protease HTRA2, mitochondrial isoform X1
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec04214  Apoptosis - fly
aec04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:aec00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105152625
   04215 Apoptosis - multiple species
    105152625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aec01002]
    105152625
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aec03110]
    105152625
Enzymes [BR:aec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     105152625
Peptidases [BR:aec01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   105152625
Chaperones and folding catalysts [BR:aec03110]
 Other chaperones and cochaperones
  DegP / HtrA
   105152625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ_6 Peptidase_S46 PDZ
Motif
Other DBs
NCBI-GeneID: 105152625
NCBI-ProteinID: XP_011065326
UniProt: F4X495
Position
Unknown
AA seq 436 aa AA seqDB search
MASSWSLVRWTCLARASNSNVSRLATFMFAKQHAGTRTFYSHQQQQQQQQQLQHGRTVFN
DGTKRLLTCTAFVAATGLGYALYNWRDNIRQGIKSLILPIPPVRAISLSDGNQKRDKFNF
IADAVEISAPSVVYIEIRDASRLDYFSGKPILTSNGSGFIINQDGLILTNAHVVANKPHT
TMKIQVRLHDGSIYSGTVEDIDLQSDLATVRINKTNLPVMKLGSSANLRPGEFVVAIGAP
LNLSNTITSGIVSSVNRPSQELGINSRNMGLIQTDAAITFGNSGGPLVDLNGEAIGINSM
KVTSGISFAIPIDYAKEFLKKAELRKKNKDVLHKDLPRRRYMGITMQTLTPEILNEMQQY
YEYMNVRHGVLIWKVMIGSPAYIAGLKPGDIVTHANDEPVLDSSNIYKILEQPGTIKLQI
LRKGRTLHIQVEPEDV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcctggtcgctcgtgcgatggacttgtttggcgagagcgagcaattcgaat
gtctcgcgactcgcgactttcatgtttgccaagcaacacgctggaactcggacgttctac
tcgcatcagcagcagcaacagcaacagcaacagttgcagcatggacgaacagtattcaat
gacggaacgaaaagactcctaacctgtaccgcgttcgtagcggcgacaggtcttggctat
gccttgtacaactggagagataacatccgacaaggaatcaagagtctgatccttccgatt
cctcccgttcgtgccatctctttgtctgacggcaaccagaaaagggacaagttcaatttt
atagcggacgcggtggagatatctgcaccatctgttgtgtacattgagatcagggatgcc
agtagattagactatttctcaggaaaaccaattcttaccagtaatggatcaggatttatc
atcaatcaggatggtttaatattaacgaacgctcatgttgtagcaaataagcctcataca
acaatgaaaatacaggtacggcttcatgatggtagtatatattctggaacagtagaagac
attgatttacaaagtgatcttgctactgtgcgaataaataagaccaatctgccagtaatg
aaacttggttcttcggctaaccttagacctggagagtttgtagtggctattggtgccccg
ttgaatcttagcaacactataacaagcggaatagtaagcagtgtaaatagaccgagtcaa
gaacttggtataaatagccgaaatatgggattaattcaaacggatgctgcaattactttt
ggaaattcaggtgggccattagtggatttgaatggagaggcgataggcataaactcaatg
aaagtgacatccggcatttcatttgctatacccatagattatgcgaaagaattcttaaaa
aaagcggagttacgcaaaaaaaataaagatgtgttacataaagatttacccaggagaagg
tatatgggcatcacaatgcaaactctgactccagaaatcttaaatgagatgcaacaatat
tatgaatatatgaatgttcggcatggagttcttatatggaaagtaatgattggatctccg
gcttatattgctggattgaagcctggagatatagtgacgcatgctaacgatgagccggtg
ctggattcgagcaatatttataaaatcttagaacaaccaggaacgataaagttacaaatt
ttaagaaaagggcgaactttacatatacaagtcgagcctgaggatgtgtag

DBGET integrated database retrieval system