KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105153797Help
Entry
105153797         CDS       T03917                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aec01001]
    105153797
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aec04131]
    105153797
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aec04812]
    105153797
   04147 Exosome [BR:aec04147]
    105153797
Enzymes [BR:aec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105153797
Protein kinases [BR:aec01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105153797
Membrane trafficking [BR:aec04131]
 Others
  Actin-binding proteins
   Others
    105153797
Cytoskeleton proteins [BR:aec04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105153797
Exosome [BR:aec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105153797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set C2-set_2 SH3_1 Pur_ac_phosph_N SH3_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 105153797
NCBI-ProteinID: XP_011067164
Position
Unknown
AA seq 11437 aa AA seqDB search
MEKEKVEEKPEEMRLKPVKQIEKPVEPKPEQIVLKPVRKLSKEEETKEEIILKPVEKEKV
GEKPEEIRLKPVKKLDKPEEPKPEQIVLKPVKKLTKEEISKEEITLKPVEKEEPKDIKLQ
PVSEMLTEIKEEKPKGEELTEIIETPWRRKRTKKVVDFKDEVIIVPIDQEESVIDVYEEK
EAMIITTKDTQDLFERKIETMPSFKEDKVTDEIITSEVSWRKKKQIHLKTEEEKEMVMLK
PIGEVEKLNLKQPEGHILDFIENEKLPEEMYEEDKVFELKSVKLEEQIAEILEEKDEIIT
ESVVTKSKVKEKVPEKISSNIVEEEAAKLQIKTDVTLVEDRKRKHRQRTQVDISITDKDK
TIAPRFIQKLQPVIAELKKTAKFTCTVIGNPLPEISWYKNEQELHASEKYTMTIFETTVT
LEITNVKEEDAGMYSCRASNPAGVATSTVNLVIFEKEEEGIAPHFSTPIKPLMIEEHTPA
LLECIVTGMPIPEVKWYRDEKEVKPNERTELSFNPTTGEAKLKILKPIPEDETIYRVRAI
NKYGRAECRANLVISNIVKVSKPIVLRAPRITRPLSALIIERGKSLKLLADFDGVPKPEV
KWFRNGIEITPTNKCKIDIYESTTELNIIEVTNKDSGKYEIRVQNEVGEARSSSSVTVKE
RKDTISEVKAPMFVEPIQPQIVAEGEVVIMETRVESYPAASFQWFHESKPLESTPQVRIV
TQENRSILMVKEVTSEFAGNYTCRAENVGGSVTCTATVNLMEITWEEAIELVSPTFVKRL
SPVKVMDGESVNLTCVVEGKPTPRVEWYHNDMPIKEGKEITIIQDMEGVCSLAITEVFPE
DAGEYTCRAVNPVGEAVCMSTLIVEAYEYVPDSEIASSIVATSLTTGQSGSEEDLLSPKE
TPIFDTDIEESVPEIIKKLPQLIPTKDGELTRLEVKVKGKPKPKGKWYKEGVEIVSSQEF
QIEEFEDGTSVLTIAETFPDDTGEIIFEAYNPLGVSTTTTYLSVEGILGTKEYRKPEWVT
QMEEMQEALKATQAVPRFIKEITDVYTKEGDIALFECTYSGNPKPDVVWYKNDKLIMNTN
NVKVRIFDKENRTTLTIKQTTKEDDATYVCKATNEIGMIVTKAKLHIDTISESRWLMPGD
IKEEEKLDIKLKKQEERPHRKKKIELKKAKEIKEKVKTERLKIEKEEICEEKLIPKEQIE
EKRTIDVEETQLLETTEFIEDKPEEVSRARRIVPIQEPIVTEAIASLKKIDDQKLQEHIP
KFEERAKQIVEEQESVVVSEITSEDIAPDFTIETKLDHAQVTSETLQQVAVSEAHVESLQ
ETKRIETKQKKIKKIKAEKIKEDITVKEIVERQKENIAREVDEIMEVLDATEFGPGESPL
RELATIGYLVRQGVSVNEINECLYKTEIFPALKTPDAQNALVQLVERKGHGPLITQVLTE
ETTTDESFVAATVGFRAFMKMVELQHATVEEVIIHFAPEDFKPRAWEVTEISEIDTEQHA
MERVDIVRKMEVHFMERKDERKATHIQDIREIKEYEDTRQAHTTLRKRKDKKPRDQIEET
TQDREEGVQSIKIEEVEEIDKERKKEEIEEEIIELERDSKGRLIRKQKQKEMEKQINTEE
EEEIIKKIRKTLIPKRSNIGRDEIQLEEIEEFEVTKDQLLPSMVLNVSSQRNQVIPLDRT
IEQAPGKPESEKAKYTLDTVIALTEQMTSVHEKEIDQVTSTKPIERKASISISSIEPYST
TETTAHISTDEFSGSFKATSYEATPSVITKESLVISETLTHDESVSNLTLTTPETSRKAD
VQVTVQEATTIRETIVNQSEIPTEDFITPLSVKAEDIVLPQISLSIYEIQEGLVENKLEP
MKTVFTKPRVNINAIEPLMVEEIHSEDKPGKYYPELIVPTEVATKSIISQRQRVTEEMNA
PEKEGAYIPGRLPPSQTAQIEISYENETAIIRHDLVQEREGEYIPERKVDSFEVTPNITL
LEGVTISMIDTQQKEDDLTIEESKQVTADLNVVEIMSAVTVETMTSEKEQDYHPEEKPTT
KLAVTSISPLEIGSVTDTIVQESEGTYSVDEKPFEILAETSIRPEEHILISQVQTADYPA
DLKDILKYVTESGIVSIQLTEAKTVLETLIHDRETSMKEDVKPEIHTIETIYDAIRGIEI
SQTTFGEKEAELKIFEMPESHRGKTVPTHPMISLEVQETQPENNLGKVMKEAVSTAIAQI
ETVSLQETIVDETVAAEDVAPTRKDKAPETMTAVISMNQIESLHTTMIVADEKETEYLDI
TDVKSAFANTEYMTQVAPIYEQVRTESPTEEYLAVDKPVSGKAYPSHIPIETISIVMQET
AEKEDVYKIDIKPEEKMANIKLTDTRPGASVLEIIPHDLENIYTPDTGPQTYTVESSITG
HTVASKAEILVEQSAGKISSDLPKSGKAIVQQEALEELIVTETNVGEVERTRDEDASPVK
QNAALQVCAQSENLTITEVTTVLKEEELLMKKLPDKQRVVLDITEGHEIAETQEMILASN
ISALKEEKPHQESVNQLQSGLDVVQQMEISVSEKESPLETDVKPDIKKVGITFQEGESLT
IEITHPEDKEDILGEKQTPKTAEATIDVITQNIASTFEIISGVVPTELSTKPIQDARPKA
TLLPFEIAVAEEVQTRETEKPFPHMLVPEKKANFEFVMGEVLVVSSVTTGDKESMLAEME
KPQSKSATFDIPTYTVAEAAEITATDNISELIREETISAMATTEHITHHSIVTSEMSTGD
SEERMLDFVKPDKKRVDISFEEETSITVTETIASDKEREYLKKPDIPGEKINTSFDAHKI
AELTEVTPAIYPGDLNVKTPETAAAKEERLPFESIVQSETIATETEIEFQDKQTKTDTAR
ISVDEIISATMSTEILGEKEDILQIPKKPTEKKAEIQFAGHIIAEKSEITPNSSTGELME
TKPTSISATFSNIPLEAIVAMETQPTEMETILKKDKIPSMVQADLSMMMEQSVEVSSVIL
EDKETEYKPKEIPKTKTAEKALIETHGVAETTIQIANISTGEIATGEAPLVAVAIPDHIV
FNPLVESQLVIQEGEEQFMPALMPENKIVNIDMEEGKVIASIKHITPADKESTYIVEEQP
RQYAASFDIDATHSIAETTAVAIEHSVGKVTIKKPDVKTVSPTHEVYQSLLVTEDMIQDQ
EKPFKDKFTPEIHKIELSVEEGKRVTSVTEIKIADKEAPLETLQEDKSRLALSVIVPGHE
VAERSEIITSSSTGEMNEVTVPTKVTALIGQKPFETVQFSEQTLVEKEIDRIQKTPLTKT
KAHVILDENRFVAITESINAQDIEEEFATKKLRLEAANLLMEGKEVAERTEINLREELGE
LPSAMKPIVCEAHKTQSTLEGIDVSEMVPQEQGAIFIDKFKPDKRSAEISFVEGKSITVD
HILTQDKEETMNIPKYEESMARVKLAKLGMDIAQKAQIFIEQNTGPIKPFEKIQAEAHIK
QDTFQPIIVHEVPSAESERTFDKYPKIIFSTAMPTFEEGHGIFITEITSAEIEASLEEKR
HEISRTAVDTIVTEHDMIETTMVESRVDVPEQPSDYISTPQIATSARDTFESIIVNENIV
EESEKTFDDLFKPTTQKVNIDITELKPLQISETIIEDKEGMLNIVSKRTEVKATSDFDLF
QTVEGSFVESIQNTRELQEEKPLSSQAIMIQTTVESIVKSETTPAEREDIFECKFQPEGQ
KGKPQFESLTTVVITETASNEIEDILPEAVTPKQHQAQLKLTGRETAEILQVVTANTTED
FTKSTKLYEQRGKPGLEELSSITVSEIISNEVENLLASKVIPKDSKADFNISGREVAETI
EVTTLSETNEFAIGGPEEQKGNQQINELIPLTISQVISNEAEETLVSAELPTGKTAQSNL
FGRDIAETTLVLTMTNAEELIPKKETEKQKGKPSLEEFMPLIISQTESQETENVLDSLNI
PTERTAQTSLYGRDIAETTEITTALSLNKFVELQKPEIQKGKPNLEELLSLNITQTVSSE
AEALLPSPEMPTEKMAQTNLSGRDVAETSQVLTMMSTEELSNQVSPDERKGKVQVEELSS
LTISQILSHETEETFESSIAPNRLTAMPMMSGREIAETSQVLTVTNAEELSRPKSPTKQK
GKPQLDELSSLLVSQVISTEIEAQLPSLEKLEEKTAIPCFLGREIAQKIEIITAATVEQI
PELKEKNDQKGKPSIEEMSSVTVSEVISTDTEQELLRPEIPKQQKALPKLPGIEVAEISE
VLTVSNVEELARSQIPEEQIGKPNLEELMSLSIFEVSYNEAEKELLAPDEPTKQIAEKTM
LGMRVAEKSQVFASLTTEEMAESAKPLIKKLTPEQIPFESIQKIESIVHESESSFLPDKK
IPSTTAEVSFGVSEGVEIIQVTATEKETKEIVKSLEEATKQIAEERMQSIYVAEKSQVIT
SSTTEEMMAFIKPEIKKIIPEQIPYVSIQQIESIPHESEHSLLPDKKTPSKKADILFRVS
EGIEVFQVTATEKEAKEVIKSLEEANQQIAEQSVLSMGIAEQSQVITSSTTENMIESVKP
EIKKIIPEQIPFESIQQTESISHERESSIVSEKDIATATADITFRVSEGVEVIQVTATEE
ETKNIIENLEKATKQIAEQTIPTMRVAEQSQTITSSTTKEMVESTKPEIKRIIPEQIPFE
SIQLVESIPHESERSLFIDKKVPTTMADVSFRVSEGVEVIQITATEKETKEIVKKEEAIK
QTAEQNILGIRVAEQSQVIASSTTEEIIEFDKPEIKTIIPKQIPFESIQQSESIPNESEH
TLLPDKKIPSTKADVSFRVSEGVEIIQVTATEEETKEVVKSVKQVTKQVAEQDMLSMSVA
EKTQVVTSSTTEEIKESSKPDVKKIIPEQIPFESILQTESILHERESLLFPDKKTPSTKA
DISFAVSEGVKVIQVTATEEETKDVAKSVEEATKQVAEQSMLSMPVAQKSQVIISSETEE
IIVSAKPEEKKIIPEQIPFESVLQTESILHEKESSLLFDKKTPITKADVSFRFSEGVEVI
QVTTTEKETKEIVKGLEETKQVAEQSMLSMPVAQKSQMIASSTTEEMMESIKPETKRIIP
EQIPFESIQQIESIPHESERSLLPDRETSIATADITFRVSEGIKVIQITATEKEIKEVVK
EETTKQKADQSMLGMFVVEQSQVVTSSTTEEMKEPVKPEIKKIIPEQIPFESIQQIESIT
HERESLLLPDKKTPSTKADVSFRVSEGVEVIQVTSTEKEIKEVAKSVEEATKQVAEQSLL
SMSVAEKTQVVPSSTTEEIRESSKPEVKKIIPEQIPFESILQTESILHERESLLLPDKKT
PSTKADISFRVSEGVKVIQVTATEEETKDVAESVEEATKQVAEQSMLSMPVAQKSQVIIS
SETEEIIVSAKPEEKKIIPEQIPFESVLQTESILHEKESSLLFDKKTPITKADVSFRFSE
GVEVIQVTATEDETKEVVKSVEEAIKQVAEQSMLSMSVAEKIQVVSSSTTEEIKESSKTE
VKKIIPEQIPFESILQTESILHERESLLLPDKKTPSTKADILFAVSEGVKVIQVTATEEE
TKDVAKSVEEATKQVAEQSMLSMPVAQKSQVITSSETEEIIVSAKPEEKKVIPEQIPFES
IQQIEAIPHERERLLLPDEKTPSTKADVSFRVSEGVEVIQVTTTEKETKEIVKGLEETTK
QVAEQSMLSMPVAQKSQVITSSETEEIIVSAKPEEKKIIPEQIPFESVLQTESILHERES
LLLPEKKTPSSKADVSFRVSEGVKVIQVTATEEETKDVVKSVKEATKQVAEQNMLSMPVA
QKSQVITSSETEEIIVSAKPEEKKIIPEQIPFEGIQQIESISHESEHLFVPDKEMTSATA
DVSFRISEGVEVIQVIATEEEIKEDVKSLEEITKQIADQSMLSMAVAEKSHVIASSSTKE
MMEFVKPDVKKITAEQIPFESVQQIETIPHESERSIIVEKVVASASAEVSFRISEGVEVT
QITPTEKEAKEVVKGLAKEEIAQADIIERKVALKTEIHPENVVSEFSVPKPDSKTAHDVK
DEKQSIIVTELQHITEIESNLSEPVIPIIPKIASTSFEADYLEKILETTEASEQQHHITV
TQHTTIHETKQPTNESDTEVIEEYTTKFKTGTKENEMAAIKTKKTIIRTKKPKTKSEEEK
IVVIEEEIEDIEPQVPPIPKKQFMHIEEVTGEIEVEEIVPTKIEELEEGTQNQEEIKPVV
QNREIAVIEEKQLLISAPIDKPKEKIVSPVLYSKFKPFEQEEIKKQITVTEEVIEGKEPK
KIIKKKIIKRKGKKQQVTEETTIEEKGQIPVTTITEGPVEEVIQESDLSLVPSEFTEPLE
KEEVKEEVTVTEIVEEKKPQKIIKKKIIKRKGQKQQVIEEITIEEEGRLPITTVTERPVE
EIIEEIILPTSHVEFIKPIEDEETREQVTVTEEVIEGKKPKKTTKNKIIKRKRQKEQVSE
ETTIKEKRQLPVTTVIESPVEEIAEETVFLLPQAEFAKLLEEEEIRETELVIVIEKLIEG
KEPKKITKKKVIKRKGQEQVTEEITIEEKGQLPITTITEGMVKEIVAEIIPSLQPEFAKP
LEEEEDKEQVTVTKEVIEEKKPKRITKNKIIKHKGQKEQVTEETTTEEQKQLPVTIVTED
TVEEIVFTPTQPEFAKHDEEEEIREQVTEEAIEGKKPKKITKKKIIKRKGQKQQVTEETT
IQEQEQLPVTTVMESPVEEVVEETVLPLLQSEFAKPFEEEDIKEQVTVTEEIIEGEKPKK
ITTKKIIKRKGQKQQVTEETTIEEKGQLPVTTVMESPVEEVVEETVLPLLQSEFAKPFEE
EDIKEQVTVTEEIIEGEKPKKITTKKIIKRKGQKQQVTEETTIEEKGQLPVTTVMESPVE
EVVEETVLPLLQSEFAKPFEEEDIKEQVTVTEEIIEGEKPKKITTKKIIKRKGQKQQVTE
ETTIEEKDQLPVTTVMESPVEEVVEETVLPLLQSEFAKPFEEEDIKEQVTVTEEIIEGEK
PKKITTKKIIKRKGQKQQVTEETTIEEKGQLPVTTVMESPVEEVVEETVLPLLQSEFAKP
FEEEDIREQVTITEEIIEGEKPKKITTKKIIKRKGQKQQVTEETTIEEKGQLPVTTVMES
PVEEVVEETVLPLLQSEFAKPFEEEDIKEQVTVTEEIIEGEKPKKITTKKIIKRKGQKQQ
VTEETTIKEKGQLPVTTVMESPVEEVVEETVLPLLQSEFAKPFEEEDIKEQVTVTEEIIE
GEQPKKIITKKIIKRKRQKQQETTVEEQGQLSVTTITEGPLEEIVEETEYSMPQSEFAKP
FEEEDIREQVTITEEIIEGEKPKKITTKKIIKQKGQKQQVTQETTIEEQGQLPVTTITEG
PLEEIVEKTVLSLSHPKFVKPCEKEEVREETKVTEIDVGKKKPKKIIKKQIIKRKGQVIE
EITVEENDKSPVTSITVGPIEEIVEETLLPLQPDFVKIEEENIKRDTLIEKPIKGEKPKK
IKKKIIKQGSTKGIIISNEDKEEQGAKVTNLHADTTPEIHIKYDEMIKSKISKKTSEGTR
EEGLYQEKESIYDIPEEIIEEVVTKEIEFQKAQLLIHKEESVEITKIDLKEPPIEKKKIS
IIEENENIEKPIQKDIKTKKVPKKKDERVKVIEEIKSEEIVEMPSKKIIKKKEHIIDTAD
VLEGAVEEIQTDMPKKEKAKTIVEDRKEIVTVTKIDTQQSIVKVPEEKIDQKPIEDTQII
AKEKIVELIETPIEKKIKRKKEKSHEDNVLQEIVEEIVLDKPEIEQAQTIFTPRESIEVV
QILTESSITKFTEVEAIPREAAIHEIKKEESPIKTILREETNTIPVQEQITIEITKEIQD
KKPKEEEIKLTIITKEGIEVTEAIPDTSTEDLLEIIKPVKETILPVKEEEPQVDIKEVTV
KKAPKRIKSVHTSKQQVKEEIVEDITLEKPTQEKAGEIIIANEEIETTEIISEIIANEID
KNKTQEEQIMPEKIDDSVKAIEIKEDRPEEAVEDIKMKKPKKEKAKKDVLLQESIEISEV
TTEIVPKEFITEKTFAEEEAESSVTPIEIIEITKVDLAVADGEITKKKKTKLRKTDIKEE
KEREIVPIEIKEITPEKKQEEEIVEKVTSSQPKLEQIKIEKVALETTEVTEIIPEVKMED
TLKEKKPEDELKEIKTIHPEKIKEFEKLKEEITSTAEEKPMELKPIEKIKEKKVIKKKKK
KIVKKDDIEEWIEPEYERPVLEPMPEKIQWEPLKKKKEKKILPESVQKLVPQKIERKEIK
PTKLKYIEPMQETVQFGTIKLKKVPIVKKKEIIEPIFPKIMLRSRVTFIDDYPAQLQIPK
VTYIEKNPIQVGILSRNTEEALQVIKKKYKKPKVLEKDLIELEKLDKEFEELKKVPLEQV
EDKSIYERTPKKLQETFEEPQKLIIGKGEIKQEDKIIPEEIKLKKIPIKKLEQVTENKEA
PKIKESIDDTPLEKEQQPQKVFTFDEFKPIKFDKPEIEKYIPEEFEITKKPETEPDSKSY
KPFKRKKPEQDMEQIPLIKGIPKPQEPEEEPEINFRIPTSEKPEDEPETIILKGWTKTKP
EEESTEEQPTKEKDIIPTTPKNITDDFTVKQKKKQKKIKEKEIKPQDSSEDTMLKNIPEE
KQEIPTEELIVKRKKSEPKEQQGELDISQEVLLKKPKQFAEDKIEAEISITKPIIKEKKE
DAKEIIEEITVKKKPKKKSITDDLAAEIVVKEPGPKEKEQMPEEISEKIVLKKPKEESVK
EEVTDEVTIEKLIIEKRKEETEEVTFKKKPKKKPVTDESAAEITVKKPIPKEEEQLPEEI
SEKVLLKKPKQEILKEEIANEVTLKKPIVEERKEDVKEVTEEITEEVTLKKKPKKKPVTE
ESAAEITVKKLVPKEEEQMPEEISKKVVLKKPKRDILKEELADEVTIKKPVIEEREEDVK
EVTEEVTLKTKPKKKPVTEEPAAEITVKKPVPKEEEQMPEEISKKVVLKKPKREILKEEL
ADEVTIKKPVIEEREEDVKEVTEEVTLKKKPKKMPVTEESAAEITVKKPVPKEEEQMPEE
ISKKVVLKKPKREILKEELADEVTIKKPVIEEREEDVKEVTEEVTLKKKPKKMPVTEESA
AEITVKKPVPKEEEQMPEEISEKVVLKKPKREILKEELADEVTIKKPVIEEREEDVKEVT
EEVTLKKKPKKMPVTEESAAEITIKKPVPKEKEQMPEEISEKVVLKKPKQEILKEDLADE
VTIKKPVIEDRKEDVKEITEEVTLKKKPKKKPVTEEPAAEITVKKPIPKEEEQMPEEISE
KVILKKPKQESLKEELADEVTIKKPVTEERKEDIKEITEEVTLKKKPKKKPITEELAAEI
TVKKPVLKKEEQMPEEISEKIILRKPKEKSLKEEVADEVTIKKLIVEERKEDVVEEITLK
PKSRKKMFETEEMSEVTIVKPVKDKKVDEEIAETSADILLREKESVPEIEDVITKELTIR
KIEIIEQPEEVIEEFTLKRKPPKKAPKPIEEIYEDVTLRKLRPKKKSRSDIREVTEVENV
TFRPRSTKRKEDVEQEFKISLNTYEEEDISMSGKVRLKSKRRPLTYSEETGEETIKIIQE
IEDYPIIEEVINESEEEGKEEYSIEELDIDEMNIPLRRKKKKQKTPYTVEEIEDDVKLQL
NRDRKYSYEEADTESLALKLKSKRRISTFEEEEASLSITKEEEISEEVEELEYVVREGDT
MFSICSYIAETEEAINLVEGEKIYIIDHINQDWWFVKKHLTEEKGWVPAQYLLDEARYTV
YLQRKLHEKIDKLPIFEKPAPGEKASAPRFIEKLQPIHTLDGYTVQFECQVEGIPRPQIT
WFRQTAIIKPSTDFQIYYDEDNVATLIIKEVFPEDAGTFTCVAKNAAGFASSTTELIVEA
PLSDHGSDVTGLSRKSLSRESSLADILEGIPPTFSRKPKAKYVNEGDDVILECRLVAVPE
PEITWHHKDIPVISQQNVIVATESDMHMYCSVVNFTKIQKKQEGRYKIIAKNREGEATID
IPVKVKTGKSEPPEILEPLQSYIVKEGETVVLSTQIVGNPSPKITWYKNGKPLKGSQLKQ
DGHVNILNLIQPQLADSGEYSVTAINDMGKAETRATLTVEKVPSGAPEPPLFTKRFQEVI
VPEKDTFKLVAKVTGNPVPEVTWLRNNKPLDKSVNIIESYDGENILLEIKNADSEVDAGD
YKCVASNSVGKASHGAKVTVDVAKVFFTRNLQNEIIVNEYKTLELSCETSHTVSTMWWHN
DKEISGMDHREIIQEGRLHKLLIKKSGLSDAGTYKCTVKNQMTFSNVIVKATKPEFVRKL
QDFEVKERDVAILEVEITSQTADVTWRKDDELLTPSKGKLEFMKDGTVRKLFIRNTSVHD
EGEYTCALLDQECTAEVTVVELPPEIIIKMQDITIATGEKATFDIELTKGDALVRWFKDG
QELQFSEHVRLSIDGKRQKLKIYDTEVEDAGIYSCQVGDQTSSARLTVEESEVDFIKKLP
DITLVPLNIDATFLIELSRADVPVTWLKKNEMIDCAQSSKYNVIDEGNIKKLIVKKCTTE
DIAEYTAAVANVKTSSRLKIEVIETSPKIHPDTLKKYKTMKGDDIDIVVKFAAKPIPIDE
WIVNGRILKKSKRIIPSIDECSAVLIIRDVQEKDCGDYTLKLTNPHGEDSIEINVIVVQV
PGAPGIPEPLEITDDSITLHWKKPDSDGHSSIIEYILEYREKTETLWSRITETIIETTYK
LTNLISDKEYTFRVTAVNEAGPGEASLNTPYLRISKLSASEPPTVLEALKSIVIGLEETV
TLSCVIGGVPTPRITWLKDGKAFEDSDITYENHLAKYTIRKTTETSSATFTVKAQNDAGM
AETSCQLKIQESPKITCDENLRKQRLTVGDKWKAEIHFSGFPKPEVTWTINNKTIIDKRI
SIETKENTSIIMISSLVRNDTAIYTVKASNEAGSSSMECHLRVIDKPSKPQGPVIAKEIR
QDRVTIEWRPPIDDGGVELERYTIEKCEMNKKAWTKVGDVDKEVENFCVQKLQQDVDYLF
RIVARNSVGSSDPLESEPIRTRTSFEIPGPPRGPLEVFGMTKTSFTLKWEPPKNDGGTPI
IEYIIEMKETSKKTWQRIASTKGEVTNVTVSDLKLDTSYNFRIIAKNNVGTGPPYTAEEV
ITTGKQPTPPSCPLNVRATNVTSKSVTLSWSPPTTTGGSELTGYVIEKRPLIGKGARWSK
VVTLDATTHQYCIENLKESEFLFRIFAENSLGLSIPTNSEPITLKTHANVPSPPTAPLEM
RQIAANTMVIEWGRPESDGGASLEGYKIAIRDAKKTMWMEVGRVSADIQKLNIRDLQENH
EYLIRIFARNEIGFSDHLESEEPFKIVPTSELSCVELIAEAMDKGETASISFSTENTSSW
LREHNMDADIHSYARARLLRKDEYFFRIWHYAKKLFE
NT seq 34314 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaaaaagtggaagaaaaaccagaggaaatgcgattgaagccagtgaaacag
atagaaaaacccgtagagccgaaaccagagcaaattgtgttgaaacctgttagaaaactt
tctaaagaggaagaaacaaaagaagaaattattttgaaaccagtggaaaaggaaaaagtt
ggagaaaaaccggaagagatccgattgaagccagtgaaaaagctggacaaacccgaagag
ccaaaaccagagcaaattgtgttgaaacctgttaaaaagctcaccaaagaagaaatatca
aaggaagaaattactttgaaaccagtggaaaaagaagaacccaaagatataaagttacaa
ccagtatctgaaatgctaactgaaattaaagaggaaaaacccaaaggtgaagagttaaca
gagataatcgaaactccttggcgacgtaaacgaacaaagaaagtcgttgattttaaggat
gaagtaataatagtgcctattgatcaagaagaatctgttatagacgtttatgaagaaaaa
gaggcaatgataattacaactaaagatactcaagatctatttgaacgaaagatagaaact
atgccatcatttaaagaagataaggtaacagacgaaattattacaagtgaagtttcgtgg
agaaagaagaaacaaatacatttaaagacagaagaagagaaagaaatggttatgttaaaa
cccattggagaagtggaaaaattaaacctaaaacaacccgaaggacatatattagatttt
atagaaaatgaaaaattacccgaagagatgtatgaggaagataaagttttcgaattaaaa
tctgtaaagcttgaggagcaaatagcagaaattttagaagagaaagatgaaatcattact
gaatcagttgtaacaaaatctaaggtaaaagaaaaagtgcctgaaaaaatctcttctaat
attgtcgaagaagaagctgccaagttacaaattaaaacagatgtcacacttgtagaagat
cgtaagagaaaacatagacaacgtactcaggtcgatatatcaattacagataaagacaaa
acgatagctccaagatttattcaaaaattacaacctgttatcgctgagttgaaaaaaact
gccaaatttacatgtactgttataggaaatccattgcctgaaatttcttggtataaaaat
gaacaagaactccatgcgagcgaaaagtatactatgactatatttgagacaacggtaacc
ttagaaatcacaaacgtcaaagaagaagatgctggaatgtattcttgtagggcatctaat
ccagctggcgtggcaacatccactgtcaaccttgtaatattcgaaaaagaagaagaaggc
atagcaccgcatttttcaacgccaattaaaccgttaatgattgaagagcatacacctgct
ttattagaatgcattgtaactggtatgccaatacctgaagtaaaatggtatcgtgacgaa
aaagaagtaaaaccaaatgaaagaacagagttgagtttcaacccaactactggagaagct
aaattgaaaattttaaaaccaatccccgaagatgaaacaatttatcgtgttcgtgctata
aataaatatggccgcgctgaatgcagagctaatttagtgatcagtaacatcgttaaagtg
agcaaaccaattgttctcagagcaccgcgaattacacgacctttgtccgctttaataatt
gagcgcggaaagtctctgaaacttctagctgattttgacggcgtaccgaaaccagaagtc
aagtggttccgcaatggtattgaaattacaccgaccaacaaatgcaaaatagacatttat
gaaagtacaaccgaattaaatataatagaagtaacaaacaaagatagcggcaagtatgag
ataagagttcagaatgaagtcggtgaagcgagaagctcgagttctgttactgttaaagaa
cgcaaagacactataagcgaagtaaaagcaccaatgtttgtggaacctattcagcctcaa
attgttgcagaaggagaagttgttatcatggaaacacgagtggaatcatatccagcagca
tcttttcagtggttccatgaaagcaaacctcttgagtcgacaccacaagtaagaattgtg
actcaagaaaatcgatcgatcttaatggtgaaagaagtcacatcagaatttgctggtaat
tacacatgtcgtgctgaaaatgtcggtggttcggttacttgtacagccaccgttaatttg
atggaaataacatgggaagaagcaattgaattagtctcaccgacattcgtaaagagacta
tcacctgtgaaagttatggacggtgagagtgttaatttaacctgcgtcgttgaagggaaa
ccaacgcccagagtggaatggtatcacaatgacatgccaattaaagaaggaaaagaaatt
acaattattcaggatatggagggtgtctgtagtttagctattaccgaagtattcccggaa
gatgctggagaatatacctgtcgtgctgtaaatcctgttggcgaagctgtttgcatgtca
acgctcattgttgaagcgtacgagtatgtgccggattctgaaattgcatcttcaatagtc
gcgacatctcttaccacaggacagagtggatcagaagaagatcttctatctccgaaagaa
actcctatttttgacactgatatagaagaatctgtaccagagataattaagaagcttcct
caattaattcctactaaagatggggaattaactagattggaagtaaaggtgaaaggcaaa
ccaaaaccgaaaggaaaatggtataaagaaggagtagaaatagtctcatcgcaagaattc
caaattgaggaatttgaagatggtacatcagtattaacaatcgccgaaactttccccgat
gacactggtgagatcatatttgaagcttacaatccactcggtgtatcaactacaactacg
tatttatcagtagaaggtatactcggaacaaaagaatacagaaaaccggaatgggtcaca
cagatggaagaaatgcaggaggctttaaaagctacacaagctgttccacgatttatcaaa
gaaataacggatgtttatacaaaagagggagatatcgctttgtttgaatgtacttattct
ggtaatcccaaaccagatgttgtttggtataagaatgataagcttataatgaatacgaac
aatgtaaaagtacgtatatttgataaagaaaacagaactactctaacaattaagcaaact
accaaagaagacgatgccacgtatgtttgcaaagctaccaatgaaattggtatgatagta
acaaaagccaaacttcatatcgatactatcagcgaatcacgctggttaatgccgggcgat
atcaaagaagaagaaaaattagatataaagcttaaaaaacaagaagagagaccgcataga
aagaaaaaaattgagttaaagaaagcgaaagaaattaaggagaaagtaaaaactgaacgt
ctcaaaattgaaaaagaagaaatctgtgaagagaaacttattccgaaggaacagatagaa
gaaaaaagaactatcgatgttgaagagactcaactattagaaactacagagtttatagaa
gataaacccgaagaggtttctagagctcgaagaatagtaccgatccaagaaccaattgta
actgaagcaatagcttctttaaagaaaattgacgatcaaaaactacaagaacatatacct
aaatttgaagaacgtgccaaacaaattgtcgaagagcaagaaagtgttgtcgtgtcagaa
atcacgagtgaagatattgctcctgatttcactatcgaaacaaaacttgatcatgctcaa
gttacctcggaaactttacagcaagttgcagtttctgaagcacatgtagaaagtttgcaa
gaaacgaaacgtatagagacaaaacaaaaaaagataaagaaaataaaagctgaaaaaatt
aaagaagatattactgtaaaagagattgtggagcgacaaaaagaaaacatagctcgggaa
gtcgatgaaataatggaggtacttgatgcgacagaatttggtccgggagaatctcctctt
cgagaactcgcgacaattggctacttggttcgacaaggtgtttccgtaaacgaaattaac
gaatgcctttacaagactgagatttttcctgctctaaagacccccgatgctcaaaatgct
ttggttcaattggtggaaagaaaaggccacggtcctttaatcacccaagtacttaccgag
gagacgacaactgacgaaagtttcgttgcagcgacagtcggttttcgtgcttttatgaaa
atggttgaacttcagcatgcaactgtagaagaagtcattatacactttgctccagaagat
ttcaaaccacgtgcttgggaagttacagaaatttccgagattgatactgagcaacatgct
atggaaagagtagatatcgttcgcaaaatggaagttcattttatggagaggaaggacgaa
aggaaagctactcacatacaggatattcgagaaattaaagaatacgaggacacacggcag
gcacacacaacattgcgtaaacgcaaagataaaaaaccaagagatcaaattgaagaaaca
acacaagatagggaagagggggttcaatctataaaaatcgaggaagtcgaggagattgat
aaagaaagaaaaaaggaagaaatcgaagaagagattattgaactcgaacgggattcaaag
ggcagattgattcgtaaacaaaaacaaaaagagatggaaaaacaaataaacacagaagag
gaagaagaaattattaaaaaaattagaaagacattaataccaaaaagatcaaacattggt
agagatgagatacaactggaagagatagaagaatttgaagtaacaaaagatcaattactg
ccgtctatggttttaaatgtatctagtcaacgaaatcaagtgataccattagatcgtaca
atcgaacaagcacctggcaaacccgaatcagagaaagctaaatacacattagatactgtt
atcgcgctaacagaacaaatgacatcagtacacgaaaaagaaattgatcaagtgacaagt
accaaacctatcgaacgtaaagcgtcaatatcaatctcatcgatagaaccatattctacc
acggaaactactgcacatatatctactgatgaattttctggatctttcaaagctacttct
tatgaagcaacaccttctgtaataacgaaagaaagtcttgtcatcagcgaaacactgact
cacgatgaaagtgtgtcaaatctaactttaactacaccagaaacaagtcgaaaagcagat
gtgcaggttactgtgcaagaagctacaactattagagagaccatagttaatcaaagcgaa
ataccgaccgaagattttataacacctttaagcgttaaagcagaagatattgtcttacca
caaatatcactttcgatttatgaaatacaagaaggtttggttgaaaataaattggaacct
atgaaaacagtatttacaaaacctcgcgttaacatcaatgcaatagaaccgttgatggta
gaagaaattcattctgaggataaaccaggaaaatattatccagagttaatagtacctact
gaagtcgctaccaaatcgataatttcgcaacgacaacgcgttaccgaagaaatgaatgca
cctgaaaaagaaggagcatacattccaggtagattaccaccaagtcaaacggctcaaatt
gaaatttcttatgaaaatgaaacagctattattcgtcatgatctcgtacaggagcgtgaa
ggcgaatatattcctgagcgaaaagtagattctttcgaagttactccaaatatcactctt
ttagaaggagtcacgatatcaatgatcgatactcaacaaaaagaagatgatttgacaatc
gaagagagtaaacaagtcacagctgacttgaatgtcgttgaaattatgtcagctgtgacg
gtagaaacgatgacatctgaaaaagaacaagattatcatcctgaagaaaagcctactact
aaactagccgttacatcgatttccccattggagattggttctgtaacagacacaattgtt
caagaatctgaaggaacttatagtgtcgatgagaaaccgttcgaaatattggcggaaaca
tcaatcagaccggaggaacacatattgatatctcaagttcaaaccgcagactatcccgcg
gatttgaaagatatactcaagtatgtcacagagagcggtattgtatccattcaattaacc
gaagcgaaaactgtccttgaaacgctcattcatgatcgagagactagcatgaaggaagat
gttaaaccggaaattcatacgatcgagaccatctacgatgctatcagaggtattgaaata
tcacaaacaacttttggagaaaaagaagccgaattgaaaatttttgaaatgcctgaatca
catcgcggaaaaacggtacctactcatccaatgatctcacttgaagttcaggaaacccaa
cctgaaaataatttaggtaaagtcatgaaagaagccgtatcaactgctatagctcaaatt
gaaacagtcagtctgcaagaaacaattgttgatgagactgttgcagcagaagatgtagct
ccgacgaggaaagataaggctcctgaaacaatgaccgccgttatttcaatgaatcagatt
gagagcttgcacactacaatgattgtagcggatgaaaaagaaactgaatatcttgatata
accgatgttaaaagtgcgtttgcaaatactgaatatatgacgcaagtagctcctatatat
gaacaagtaagaacagaatcaccgaccgaagagtacctagcggtagacaaacctgtgagt
ggaaaagcatatccatctcatattcctatagaaactatcagtatcgttatgcaagaaacc
gcagaaaaggaagatgtttataaaatagacataaaacccgaagaaaagatggcgaacatt
aaactcacagacacgaggcctggtgccagcgttctagaaataattccacatgatctcgag
aatatctacacgccagatactggaccacagacttatacggttgaatcgtccataactggt
cataccgtcgcgtcaaaggcagagatcttagtggaacaaagtgctggaaaaataagcagt
gatctaccaaaatcaggtaaagcaatagtacaacaagaagctctggaagaattgatagta
acagaaacaaatgtcggcgaagtagaacgaaccagggatgaggatgcgagtcctgttaaa
caaaatgccgcacttcaagtatgcgctcaatctgaaaatttgaccatcactgaagtaact
accgtattgaaggaagaagaattattaatgaaaaaattaccagacaaacaaagggttgta
ttagatataactgagggccatgaaattgctgaaacacaagagatgattcttgcaagcaat
ataagtgcattgaaagaagaaaaaccacatcaagaaagtgtcaatcaactgcaaagcgga
ttagatgttgtacaacaaatggaaatatcagtatctgagaaagaatctcctttagaaacg
gatgtaaaacctgatattaaaaaagttggtattacttttcaagaaggagaaagtctgaca
attgaaattacgcatcctgaagacaaagaagatatacttggtgaaaaacagacgccaaaa
acagccgaagctacaatagacgtaataacacaaaatatagcctcgacatttgagattatt
agtggtgtcgttccaactgaattatctaccaaacctatccaagatgcacgtcctaaagcg
acattattaccatttgaaatagccgttgctgaagaagtgcaaacaagagaaactgaaaaa
ccttttcctcatatgttggtaccagagaaaaaagctaattttgaatttgtaatgggtgaa
gttcttgttgtttcttctgtaacaacgggtgacaaagaaagcatgcttgcagaaatggaa
aaaccacaatcaaaatctgctactttcgatattcctacttatactgtggcagaagctgct
gaaataaccgcaactgacaacattagcgaattaatacgcgaagaaacaatctccgcaatg
gctacgaccgaacatataactcatcatagtatcgttacatccgaaatgtcaaccggtgac
tcagaagagcgtatgcttgatttcgtcaaaccagataaaaaaagagtagatatatcgttt
gaagaagaaacaagcataacagtcactgaaacaattgcgtctgataaggagcgagaatat
ttgaagaaaccggatattccaggtgaaaaaattaacaccagctttgacgctcataaaatt
gccgaacttactgaggttacaccagccatttatccaggagacctcaatgtgaaaacacca
gagacagcagcagcaaaagaggaacgtttgccgtttgagagtatcgttcaaagcgaaact
attgcaacagaaacagaaatagaatttcaagataaacaaaccaaaaccgacactgctcga
atatccgtcgacgagattatcagtgctactatgtctactgagattttaggtgaaaaggaa
gatattcttcaaattcccaaaaaacctacagagaaaaaagccgagattcaatttgccgga
catattattgctgaaaaaagcgaaatcactccaaattctagcactggagaattgatggag
acaaaaccgacttctatttcagccacattctcgaatattccgttagaggcaatagtagca
atggaaactcagccaacagaaatggagactatactcaagaaagataaaataccatcgatg
gttcaagctgatctttccatgatgatggaacaaagtgtagaggtatcttcggtaatttta
gaggataaagaaacagaatataagcctaaggaaataccaaaaacaaaaacagcagagaaa
gctctaatcgaaactcatggcgtcgccgaaacaacaatacaaatcgctaatattagcact
ggtgaaattgctactggcgaagcaccactggttgccgtcgcaattccagatcacatagtg
tttaatccactagtagaatcacagcttgttattcaagaaggagaagagcaatttatgcca
gcattaatgccggaaaataaaattgtaaacatcgatatggaagaaggtaaagtcatcgcg
agtataaaacatataacaccagcagataaagaatcgacatatatcgtcgaggaacaaccg
cgtcaatacgctgcttcattcgacatcgatgctactcacagtatagcagaaacgaccgcg
gtagctattgaacattctgtaggaaaagtaaccatcaaaaagccagacgttaaaaccgta
tcacctacacatgaagtatatcaaagtcttttagtaactgaagacatgattcaagatcaa
gagaaacccttcaaagacaaattcacgccagaaatacacaaaatagaattatctgtcgaa
gaaggtaagcgcgttacctctgtgacggaaattaaaatagctgacaaagaagctcccctt
gaaacattacaagaagataaatctcgcttagcactctcggttattgttcctggtcacgaa
gtcgctgagagatctgaaataattaccagttcaagtacaggtgaaatgaacgaagttaca
gtaccaacaaaagtaaccgcgctaattggtcaaaaaccgtttgagacagtacaattctcc
gaacaaaccttagtggagaaagaaatagataggattcagaaaacaccattaacaaaaaca
aaagcgcatgttattttagatgaaaatagattcgttgctattacagaatctattaatgct
caagatattgaagaggaatttgctacaaagaaacttcgtcttgaagcggcaaatctttta
atggaaggtaaagaagtagctgaacgaacggaaattaatttacgcgaagaactcggagaa
ttaccttcagcaatgaaaccgattgtatgtgaagcacataaaacacaatctactttggaa
ggtattgacgtcagtgaaatggttcctcaagagcaaggtgcaatattcattgataaattc
aaacccgataagcgtagcgccgagattagtttcgtcgaagggaaaagtattaccgtagat
catatcttaacacaagacaaagaagaaacaatgaatattccgaaatacgaagagagtatg
gcaagagtaaaattagcaaaacttggtatggatattgctcaaaaggctcaaatatttatc
gaacaaaatactggaccgattaaacctttcgaaaagatacaagctgaagctcacataaaa
caagacacatttcaacctattatagttcatgaagttccaagtgcggaaagcgaacgtact
ttcgataagtatccgaagataatattcagtacagctatgccaacattcgaagaaggtcat
ggtatatttattacggagataacatctgccgaaatcgaagcatcactggaagagaagaga
catgaaatatcgcgaacagctgtcgatactattgttactgagcacgatatgatagagacc
acaatggtagaatcgcgagtagacgtacctgaacaaccttcagattatatttcaacacct
caaattgccacatcagcgcgagacacgtttgaaagcattattgttaacgagaatattgtt
gaagaaagcgagaaaacttttgatgatctttttaaacctacgacacaaaaagtgaatatt
gatataacggagttaaagccgttacaaatttcagaaacaattatcgaagacaaggaagga
atgttgaatattgtttcaaagcgaactgaagtcaaagctacatcagatttcgatttattc
caaactgttgaaggttctttcgtagaaagtatacaaaatactcgagaacttcaagaagaa
aaaccactttcctctcaagcaattatgattcagaccacggtagaatcaatagtaaagtca
gaaacaacaccagccgaaagagaagacatctttgaatgcaaattccaacccgaagggcag
aaaggcaaaccacaattcgaaagtcttacaacggttgtaattactgaaacagcttctaat
gaaatcgaagatatcttacctgaagccgttacaccaaaacaacatcaggcacaattaaaa
ttgacaggcagagaaaccgcggaaatccttcaagtagtaacagcgaatacaaccgaagat
tttacaaaatctactaaattatatgaacaaagaggtaaaccaggactcgaagaattgtca
tccataactgtttccgaaattatttccaatgaagttgaaaatcttttagctagtaaagtt
attccaaaagatagcaaggctgatttcaatatttctggtagagaagtcgctgaaacaatt
gaagtaacaacattatctgagaccaatgaatttgctataggaggacctgaggaacagaaa
ggcaaccaacaaatcaatgagttaattccactgactatttcacaagtaatttctaatgag
gctgaagaaacattagttagtgctgagcttcctacggggaaaacagcacaatcaaatttg
tttggtagagatatcgcggaaacaacactagttttaacaatgactaatgccgaagaactt
attcctaaaaaagaaactgaaaaacaaaaaggtaaacccagtctcgaagaattcatgcca
ttaataatttcacaaacagaatctcaagaaactgaaaatgttcttgatagtctcaacata
ccaactgaaagaacggcgcaaacaagtttatatggcagagacatagcagaaactacagaa
ataacaactgcgttaagtctaaataaatttgttgaacttcaaaagcccgagatacaaaag
ggaaaaccaaatctcgaagaattattatccttaaatataacgcaaactgtatccagtgaa
gcggaagctttattgcctagtccggaaatgcctacggaaaaaatggcgcaaactaattta
tctggtagagatgtagctgaaactagtcaagttttaacaatgatgagcacagaggaactt
tcaaatcaagtatcacctgacgaacgtaaagggaaagtacaagtagaagaattatcgtcc
ttgactatatctcaaatattatctcatgaaaccgaagaaactttcgagagttccattgca
cctaacagactcactgcgatgcctatgatgtctggtagagaaattgccgagacttctcag
gtgcttactgtcacaaatgctgaagaactttcgagacctaaaagtccaacaaaacagaaa
ggtaaaccacaactagacgaactttcttcacttttggtttctcaagtaatatctacagag
atagaagcacaactgccaagtttagaaaaattagaagagaaaacagccataccatgtttc
ttaggtagagaaatagctcagaaaatcgaaattataaccgctgcaactgtagaacaaata
cctgaattgaaggaaaaaaatgatcaaaaaggaaaaccaagcattgaagaaatgagttct
gttactgtgtctgaagtaatttctactgatacagaacaagaattactgagaccagagatt
ccaaaacagcaaaaagctctcccaaaactacccggcatagaagtcgcggagatatcagaa
gttttgacagtgagtaacgttgaagagcttgcaagatcacaaattcccgaagaacagata
ggtaaaccaaacttagaagaactaatgtcattgtcgatctttgaagtatcttataatgaa
gcagaaaaagaattacttgcaccagatgaaccaactaaacaaatagccgaaaaaactatg
ctaggcatgcgcgttgccgagaaatcgcaagtgtttgcgtcgttgacaacggaggagatg
gcagagtcagctaaacctctgataaaaaagttaacaccagaacaaataccttttgagagt
atacaaaaaattgagtcaattgttcatgaaagcgaaagttcatttcttcccgataaaaag
ataccaagtaccacagccgaggtttcattcggcgtttctgaaggtgtcgaaattattcaa
gtaaccgcaacagagaaggaaacaaaggagattgttaaaagcctagaagaagcaactaaa
cagatagctgaagaaagaatgcagagtatttacgttgcagaaaagtctcaggtaattaca
tcatcaacaacagaagagatgatggcatttattaagccagagataaagaaaataataccc
gaacaaataccgtatgtaagcatacagcaaattgaatcaattccccacgaaagcgagcat
tcgcttcttcctgataagaagacaccaagtaaaaaagctgatattttattccgcgtttcc
gaaggcatcgaagttttccaagtaactgctacggagaaagaagcaaaagaagtaataaaa
agtttggaagaagcaaatcaacaaatagccgagcagagcgtgttgagcatgggcattgca
gaacagtcacaagtaattacatcgtcaacaacagagaacatgattgagtccgttaaaccg
gaaataaagaaaataataccagaacaaataccgtttgaaagtatacaacaaactgaatcg
atttctcacgaaagagaaagttcgattgtttctgaaaaagatatagctactgcaacggcc
gatattacatttcgcgtttctgaaggcgtcgaagttattcaggtaaccgctacggaagag
gaaacgaaaaacattatagaaaatttggaaaaagcaacgaaacagatagctgaacaaacg
ataccgactatgcgtgttgcagaacaatctcaaactattacttcatcaacaacaaaagaa
atggtagaatctacaaaacctgagataaagagaataataccggaacaaataccgtttgaa
agtatacaactggttgaatcaattcctcatgaaagtgaacgttcacttttcatagataag
aaagtaccaactacaatggctgacgtttcattccgcgtttccgaaggagtcgaagttatt
caaataacagctactgaaaaagaaacaaaagaaatagtaaaaaaagaagaagcaattaaa
cagacagcagagcaaaatatactgggcatacgcgttgcagaacagtctcaagtaattgcg
tcgtcaacaacggaagaaattatagaatttgataaacctgaaataaagacaataataccg
aaacaaataccatttgaaagcatacagcagtccgagtcaatccctaatgaaagtgagcac
acgcttctccctgataagaagataccaagtacaaaagccgatgtttcattccgtgtttcc
gaaggcgtcgaaattattcaagtaactgctacggaggaggaaacaaaagaagttgtaaaa
agtgtgaaacaagtaactaaacaagtagcggagcaagatatgttaagcatgtccgttgct
gaaaaaactcaagtagttacatcatcgacaacggaggaaattaaagaatcttcaaagcct
gatgtaaagaaaattattccagaacaaataccgttcgaaagtatactacaaaccgaatca
attcttcatgaaagagaaagtttgcttttccccgataagaaaacgccaagtacaaaagcc
gatatttcattcgccgtttctgaaggcgttaaagttattcaagtaaccgctacggaagag
gaaacgaaggatgttgctaaaagtgtagaagaagcaactaaacaagtagccgaacagagc
atgttaagtatgcccgttgctcaaaaatctcaagtaattatatcatcagaaacagaggaa
attatagtgtctgccaaacctgaggaaaagaaaatcattccagaacaaataccgttcgag
agtgtactacaaaccgaatcaattcttcatgaaaaagaaagttcgcttcttttcgataag
aaaacaccaattacaaaagctgatgtttcattccgtttttctgaaggagtcgaagttatc
caagtaaccactacggagaaggaaactaaagaaatcgtaaaaggcttggaagaaacaaaa
caagtagccgagcagagcatgctgagtatgccagttgctcaaaaatctcaaatgattgca
tcctcaacaacagaagaaatgatggaatctattaaacctgaaacgaaaagaataattccg
gaacagataccatttgagagtatacaacaaattgaatcaattcctcatgaaagcgaacgc
tcgcttcttccggatagagaaacatcaatcgcaacggccgatattacattccgcgtttcc
gaaggcatcaaagttatacaaataaccgctacagaaaaggaaataaaagaagttgtaaaa
gaagaaacaactaaacaaaaagctgatcagagtatgttaggtatgttcgttgtagaacaa
tctcaagtagttacatcatcaacaacagaagagatgaaagagcctgttaaaccagagata
aagaagataatacccgaacaaataccgtttgaaagtatacaacaaatcgaatcaattact
catgaaagagaaagtttgcttctccccgataagaaaacgccaagtacaaaggccgatgtt
tcattccgtgtttccgaaggtgtcgaagttattcaagtaacatccacggagaaagaaata
aaagaagttgcaaaaagtgtagaagaagcaactaaacaagtagccgagcagagcttgtta
agtatgtctgttgctgaaaaaacccaagtggttccatcatcaacaacggaggaaattaga
gaatcttcaaagcctgaggtaaagaaaattattccagaacaaataccgttcgaaagtata
ctacaaaccgaatcaattcttcatgaaagagaaagtttgcttctccccgataagaaaacg
ccaagtacaaaggccgatatttcattccgcgtttctgaaggcgttaaagttattcaagta
accgctacggaagaggaaacgaaggatgttgctgaaagtgtagaagaagcaactaaacaa
gtagcagaacagagcatgttaagtatgcccgttgctcaaaaatctcaagtaattatatca
tcagaaacagaggaaattatagtgtctgccaaacctgaggaaaagaaaatcattccagaa
caaataccgttcgagagtgtactacaaaccgaatcaattcttcatgaaaaagaaagttcg
cttcttttcgataagaaaacaccaattacaaaagctgatgtttcattccgtttttctgaa
ggagtcgaagttatccaagtaaccgctacggaggatgaaacaaaagaagttgtaaaaagt
gtggaagaagcaattaaacaagtagccgaacaaagcatgttaagtatgtccgttgctgaa
aaaatccaggtggtttcgtcatcaacaacagaagaaattaaagaatcttcaaagactgaa
gtaaagaaaattattccagaacaaataccgttcgaaagtatactacaaaccgaatcaatt
cttcatgaaagagaaagtttgcttctccccgataagaaaacgccaagtacaaaagccgat
attttattcgccgtttctgaaggcgttaaagttattcaagtaaccgctacggaagaggaa
acgaaggatgttgctaaaagtgtagaagaagcaactaaacaagtagccgaacagagcatg
ttaagtatgcccgttgctcaaaaatctcaagtaattacatcatcagaaacagaagaaatt
atagtgtctgccaaacctgaagaaaagaaagtcattccagagcaaataccattcgagagc
atacaacagattgaagcaattcctcatgaaagagaacgtttgcttctcccagatgaaaag
acaccaagtacaaaagccgatgtttcattccgagtttctgaaggagtcgaagttatccaa
gtaaccactacggagaaggaaactaaagaaatcgtaaaaggtttggaagaaacaactaaa
caagtagccgagcagagcatgctgagtatgccagttgctcaaaaatctcaagtaattaca
tcatcagaaacagaggaaattatagtatctgccaagcctgaggagaagaaaatcattcca
gaacaaataccgttcgagagtgtactacaaaccgaatcaattcttcatgaaagagaaagt
ttgcttctccctgaaaagaaaacgccaagttcaaaggctgatgtttcattccgcgtttct
gaaggcgtcaaagttattcaagtaaccgctacggaagaggaaacaaaggatgttgtaaaa
agtgtaaaagaagcaactaaacaagtagccgaacaaaatatgttaagtatgcccgttgct
caaaaatctcaagtaattacatcatcagaaacagaggaaattatagtatctgccaaacct
gaggaaaagaaaatcattccagaacaaataccatttgaaggcatacaacaaattgaatca
atttctcacgaaagcgaacatttatttgttcctgacaaagaaatgacaagcgcaacagct
gatgtgtcattccgcatttccgaaggagtcgaagttatccaagtaatcgctacggaggaa
gaaataaaagaagacgtaaaaagtttggaagaaataactaaacaaatagccgatcaaagc
atgttaagcatggcagttgctgaaaaatctcatgtgattgcatcatcatcaacgaaggaa
atgatggaattcgttaaacctgatgtaaagaaaataacagcagaacaaataccatttgag
agtgtacaacaaatagaaacgattcctcatgaaagtgaacgttctattatcgttgaaaaa
gtggtagcaagtgcttcagccgaagtttcatttcgcatttccgaaggtgttgaagttacc
caaataactcctacagagaaagaagcaaaagaagttgtcaaaggtctcgctaaggaagaa
atcgcgcaagcggatataattgaacgaaaagttgctctaaaaactgaaattcatccggaa
aatgtagtatcggaattcagtgttccaaaaccagacagtaaaacagctcatgatgtaaaa
gatgaaaaacaaagtataattgttactgaattgcaacacattactgaaattgaatcaaat
ctgtccgaacccgtaattccaataataccaaaaatagcaagcacatcttttgaagccgac
tacttagaaaaaattttagaaactacagaagcatcagagcaacaacatcatatcacagtc
acacaacacaccacaatacacgaaacaaaacaaccaacaaatgaatctgatactgaagta
attgaagaatataccacaaaatttaaaaccggcactaaagaaaatgaaatggcagcgatt
aaaacaaagaaaactataattcgtacaaagaaaccaaaaactaaatcagaagaagaaaaa
attgtagtaattgaagaagaaatagaagacatagaaccacaagtaccacctataccaaaa
aaacaatttatgcacatcgaagaagtaacaggagaaatagaagtagaagaaatagtacca
acaaaaattgaagaattagaagaaggcactcaaaatcaagaagaaataaaaccagtagta
caaaatcgagaaatagcagttatagaagaaaaacaattattaataagtgcacctatagat
aaaccaaaagaaaaaatcgtttctcctgtactatattctaaattcaaaccctttgaacag
gaagaaataaagaaacaaataacagtgactgaagaggtaatcgaaggaaaggaaccaaaa
aagataattaaaaagaaaatcattaaacgtaaaggaaagaaacagcaggtaacagaagaa
acaacaatagaggaaaaaggacaaatacctgtaacaacaattacagaaggtccagtagaa
gaagtcattcaagaatctgatctatcactagtaccttctgaattcacagaaccccttgaa
aaggaagaggtaaaagaggaagtaacagtaactgaaatagtggaggagaagaaaccccag
aaaataattaagaaaaaaattatcaaacgtaaaggacagaaacagcaagtgatcgaagaa
ataactatagaagaagaaggacgattacctataactacagttacagagagaccagtggag
gaaatcattgaagaaattattcttcctacatcacatgtagaattcatcaagcccattgaa
gatgaagaaacaagggagcaagtaacagtgactgaagaagtaatcgaaggaaaaaaaccg
aaaaagaccactaaaaacaaaataattaaacgcaaaaggcagaaagaacaagtgtcagaa
gaaacaactataaaggaaaagagacaattacctgtaacaacagttatagaaagtccagta
gaagaaattgccgaagaaactgtattccttttgccacaggctgaatttgcaaagctcctt
gaagaggaggaaataagagagacggagctagttatagtgattgaaaaattaattgaagga
aaagaaccgaaaaaaatcactaaaaagaaagttattaaacgtaaaggacaggaacaagtg
acagaagagataacaatagaggaaaagggacaactacctataacaacaattacggaaggt
atggtaaaagaaattgtcgcagaaatcattccttcactacaacctgaattcgctaagcct
cttgaagaggaggaagacaaggagcaagtaacagtaactaaagaagtaatcgaagaaaag
aagccgaaaagaatcactaaaaacaaaataattaaacataaaggacagaaggagcaggta
acggaagaaacaactacagaggaacagaaacaactacctgtgacaatagttacggaagat
acagtagaagaaattgtatttactcccactcaacctgaattcgccaaacatgatgaagaa
gaagaaatacgagagcaagtaactgaagaagcaatcgaaggaaagaagccgaaaaaaatc
actaaaaagaaaattattaaacgcaaaggacaaaaacaacaggtaacggaagaaacaact
atacaggaacaggaacaactacctgtaacaacagtcatggaaagtccagtagaagaagtt
gttgaagaaactgtacttcctctattacaatccgaattcgctaagccctttgaagaagaa
gacataaaggagcaagtaacagtaactgaagaaataattgagggtgaaaaaccgaaaaag
attactacgaagaaaattattaaacgtaaaggacagaaacagcaagtaacagaagagaca
actatagaggaaaagggtcaactacctgtaacaacagtcatggaaagtccagtagaagaa
gttgttgaagaaactgtacttcctctattacaatccgaattcgctaagccctttgaagaa
gaagacataaaggagcaagtaacagtaactgaagaaataattgagggtgaaaaaccgaaa
aagattactacgaagaaaattattaaacgtaaaggacagaaacagcaagtaacagaagag
acaactatagaggaaaagggtcaactacctgtaacaacagtcatggaaagtccagtagaa
gaagttgttgaagaaactgtacttcctctattacaatccgaattcgctaagccctttgaa
gaagaagacataaaggagcaagtaacagtaactgaagaaataattgagggtgaaaaaccg
aaaaagattactacgaagaaaattattaaacgtaaaggacagaaacagcaagtgacagaa
gagacaaccatagaggaaaaggatcaactacctgtaacaacagtcatggaaagtccagta
gaagaagttgttgaagaaactgtacttcctctattacaatccgaattcgctaagcccttt
gaagaagaagacataaaggagcaagtaacagtaactgaagaaataattgagggtgaaaaa
ccgaaaaagattactacgaagaaaattattaaacgtaaaggacagaaacagcaagtgaca
gaagagacaaccatagaggaaaagggtcaactacctgtaacaacagtcatggaaagtcca
gtagaagaagttgttgaagaaactgtacttcctctattacaatccgaattcgctaagccc
tttgaagaagaagacataagagagcaagtaacaataactgaagaaataattgagggtgaa
aaaccgaaaaagattactacgaagaaaattattaaacgtaaaggacagaaacagcaagtg
acagaagagacaaccatagaggaaaagggtcaactacctgtaacaacagtcatggaaagt
ccagtagaagaagttgttgaagaaactgtacttcctctattacaatccgaattcgctaag
ccctttgaagaagaagacataaaggagcaagtaacagtaactgaagaaataattgagggt
gaaaaaccgaaaaagattactacgaagaaaattattaaacgtaaaggacagaaacagcaa
gtgacagaagagacaaccataaaggaaaagggtcaattacctgtaacaacagtcatggaa
agtccagtagaagaagttgttgaagaaactgtacttcctctattacaatccgaattcgct
aagccctttgaagaagaagacataaaggagcaagtaacagtaactgaagaaataattgag
ggtgaacaaccgaaaaagattattacgaagaaaattattaaacgtaaaagacagaaacag
caggaaacaactgtagaggaacaaggacaattatctgtaacaacaattacagaaggtcca
ttagaagaaatcgttgaggaaactgaatattctatgccacaatccgaattcgccaagccc
tttgaagaagaagacataagagagcaagtaacaataactgaagaaataattgagggtgaa
aaaccgaaaaagattactacaaagaaaattattaaacagaaaggacagaaacagcaggta
acacaagaaacaactatagaggaacaaggacaactacctgtaacaacaattacagaaggt
ccattagaagaaatcgtagagaaaactgttctttcactatctcatcccaaatttgtaaaa
ccttgtgaaaaggaagaagtaagggaggaaacaaaagtaactgaaatagacgttggaaag
aaaaaaccgaaaaaaatcattaaaaagcaaattattaaacgtaaaggacaagtgattgaa
gaaataactgtagaagaaaatgataagtcacccgtaacatcaattacggttggcccaatc
gaagaaattgttgaagaaactttattacctttacaacctgatttcgtcaaaattgaagaa
gaaaatataaaaagagatacattaattgaaaagccaataaaaggagaaaaaccaaagaag
attaaaaagaaaattattaaacaaggaagtaccaaaggaataattataagtaatgaggac
aaagaggaacagggggcaaaagttacaaatcttcacgcagacactacacctgaaatacac
attaaatacgatgaaatgataaaatctaaaatcagtaaaaagacttcggaaggtaccaga
gaagaagggctgtatcaggaaaaagaatcaatttacgatatacctgaagaaattatagaa
gaagttgtaacaaaagaaatagagtttcaaaaagctcaactccttatacataaagaagaa
tcggtagaaattacaaaaatagatctcaaggaaccaccaatagaaaaaaagaaaatatct
atcatagaagagaacgagaatattgaaaaaccgatacagaaagacattaagacaaaaaaa
gtaccaaagaaaaaggatgaacgtgtcaaggtaatcgaggaaataaaatcagaggaaatt
gttgaaatgccatccaaaaaaataattaagaaaaaggaacatataatagacactgctgac
gttcttgagggagccgtagaagaaatccaaacggacatgccaaagaaagaaaaggctaaa
actatcgtggaagacagaaaagaaattgttacagttacaaaaatagatacacagcaatca
attgttaaagtacctgaggagaaaattgatcaaaaaccaattgaagatactcaaataatt
gctaaagaaaaaatagtcgaacttatcgaaacaccaatagaaaagaaaataaagagaaaa
aaggaaaaatctcatgaagataatgtgctacaagaaattgttgaagaaattgttttagat
aaaccagaaatagaacaagctcaaactatattcactcctagagaaagtatcgaagttgtg
caaatcttaactgaatcctccattactaaattcacagaagttgaagctataccaagagaa
gctgcgatacatgaaattaaaaaagaagaaagcccaataaagacaattttacgggaagaa
acaaacacgattcctgtgcaggaacaaattactatcgaaattactaaagaaatacaggac
aaaaaaccaaaagaagaagaaataaaattgactattataacaaaagaaggaattgaagtt
actgaggcaattccggacacttctactgaggatcttcttgaaataataaaaccagtgaaa
gaaacgatactgccagtgaaagaagaggaaccacaagttgatataaaagaagttactgtg
aagaaagcaccgaaaaggattaaatcagtacatacaagtaaacaacaagttaaagaagaa
attgttgaagatattacattagaaaaaccaacacaagaaaaagcgggagaaataataatt
gcaaatgaggaaatagaaactacggaaattatttccgaaatcatagccaatgaaattgat
aaaaataaaacacaagaagagcaaattatgccagaaaagatagatgatagtgtaaaagct
atagaaataaaggaagaccgaccagaggaagcagtagaggatataaaaatgaaaaagccc
aaaaaggaaaaggctaaaaaggatgtgcttttacaagaaagtattgaaatttcagaagta
acaacagaaatagtacctaaagaattcatcacagaaaaaacatttgctgaagaggaagca
gaatcaagtgttacaccaatagaaattattgaaattactaaagttgatctagctgtagca
gatggtgaaataacaaaaaagaaaaaaacaaaacttagaaagactgacattaaagaagaa
aaagaaagagaaatagttcctatcgaaataaaagagatcactccagaaaaaaaacaggaa
gaagaaatagtagaaaaagtaacatccagccaacctaaattagaacaaataaaaatagag
aaagttgcattagaaactacagaagtgacagaaataattccagaagttaaaatggaagat
actttaaaggagaaaaaacccgaagatgaattgaaggaaataaaaacaatacaccccgaa
aaaataaaggaatttgaaaaactaaaagaagaaattacgtctactgcagaagaaaaacca
atggagcttaaacctatcgagaaaataaaagaaaagaaagttataaagaaaaagaagaaa
aaaatcgtcaagaaagatgatatagaggaatggatagaacctgagtatgaaagacctgta
ttagaaccaatgcctgaaaaaattcaatgggagccattaaaaaagaagaaagaaaagaaa
atattgcctgaatctgtgcaaaaattagttccacagaaaattgaaagaaaagaaatcaaa
cctacaaaattaaaatatattgaaccaatgcaagaaacagtccaatttggcacgattaaa
ttgaaaaaagtaccaattgttaagaaaaaagaaataattgaaccaatatttcctaaaatc
atgttacgaagtagagttacatttatcgatgactatccggcacaattacaaataccaaaa
gttacgtatatagaaaaaaatccaatacaagttggcattttatctagaaatacagaagaa
gcattacaagttataaagaagaaatacaaaaaacctaaagtcttagagaaagatttgatt
gaattagagaaattagataaagagtttgaagaactaaaaaaggttcctttagaacaagta
gaagataaatctatttatgaacggacacccaaaaagttacaggaaacgttcgaagaacca
caaaagctcattattggaaaaggtgaaataaaacaagaagataaaattataccggaagag
atcaaactaaagaaaataccgataaagaaattagaacaagtaacagaaaataaagaagca
cctaaaataaaagaatccatagacgatacgcctctagaaaaagaacaacaacctcaaaaa
gtattcacatttgatgaattcaaaccaataaaatttgataagccagaaattgaaaaatat
atacctgaagaattcgaaataaccaaaaaaccagaaactgaacctgactcgaagtcatat
aaaccatttaagagaaaaaaacctgaacaagatatggagcaaattcctttaataaagggt
ataccaaaaccacaggaacctgaagaagaacccgagatcaatttccgaataccaacttca
gaaaaacccgaagatgaacctgaaacaataattttaaaaggctggacaaaaactaaaccc
gaagaagaaagcacagaagaacagccaactaaggaaaaagacattataccaacaacgccc
aaaaacattactgatgactttacagtaaaacagaagaaaaaacagaaaaagatcaaagag
aaagaaataaaaccacaggacagtagtgaagatactatgttaaaaaatattcctgaagaa
aagcaagagataccaacagaagaattaattgtaaaaagaaagaagtcagaaccaaaagaa
cagcaaggtgaattagatatttctcaagaagtgttattaaaaaaaccaaagcagtttgct
gaagacaaaatagaagctgaaatatcaattacaaaaccgattattaaggagaagaaagaa
gatgccaaagaaatcattgaagaaattacagtaaagaaaaaaccaaagaaaaagtccata
accgatgaccttgctgctgaaatagttgtaaaagaacccggtccaaaagagaaagaacaa
atgccggaagaaatctctgaaaaaatagtactaaagaaaccaaaagaagaatctgtcaag
gaggaagtcactgacgaagtaacgattgaaaaattaattattgaaaaaagaaaagaagaa
actgaggaagttacatttaaaaagaaaccaaagaaaaaacccgttacagacgaatctgct
gcagaaataactgtaaagaaacccattccaaaagaggaagagcaattgccggaagaaatc
tctgaaaaagtgttactaaagaaaccaaaacaagaaattctcaaggaagaaatcgcaaat
gaagtgacacttaagaaacctattgtcgaagaaagaaaagaagatgtaaaagaagtcact
gaagaaatcactgaagaagttacgttgaaaaagaaaccaaagaaaaagcctgttacagag
gaatctgctgctgaaataactgtaaagaaactcgttccaaaagaggaagagcaaatgccg
gaagaaatctctaaaaaagtggtactaaagaaaccaaaacgagacattctcaaagaagaa
ctcgcagatgaagtgacgattaagaaaccagttattgaagaaagagaagaagatgtaaaa
gaagtcacagaagaagttacgttgaaaacgaaaccaaagaagaagcccgttacagaagaa
cctgctgctgaaataactgtaaagaaacccgtcccaaaagaggaagagcaaatgccggaa
gaaatctctaaaaaagtggtactaaagaaaccaaaacgagaaattctcaaagaagaactc
gcagatgaagtgacgattaagaaaccagttattgaagaaagagaagaagatgtaaaagaa
gtcacagaagaagttacgttaaaaaagaaaccaaagaaaatgcccgttacagaggaatct
gctgctgaaataactgtaaagaaacccgttccaaaagaggaagagcaaatgccggaagaa
atctctaaaaaagtggtactaaagaaaccaaaacgagaaattctcaaagaagaactcgca
gatgaagtgacgattaagaaaccagttattgaagaaagagaagaagatgtaaaagaagtc
acagaagaagttacgttaaaaaagaaaccaaagaaaatgcccgttacagaggaatctgct
gctgaaataactgtaaagaaacccgttccaaaagaggaagagcaaatgccggaagaaatc
tctgaaaaagtggtactaaagaaaccaaaacgagaaattctcaaagaagaactcgcagat
gaagtgacgattaagaaaccagttattgaagaaagagaagaagatgtaaaagaagtcaca
gaagaagttacgttaaaaaagaaaccaaagaaaatgcccgttacagaggaatctgctgct
gaaataactataaagaaacctgttccaaaagagaaagagcaaatgccggaagaaatctct
gaaaaagtggtactaaagaaaccaaaacaagaaattctcaaggaagatctcgcagatgaa
gtgacgattaagaaaccagttatcgaagacagaaaagaagatgtaaaagaaatcaccgaa
gaagttacgttgaaaaagaaaccaaagaagaagcccgttacagaggaacctgctgccgaa
ataactgtaaagaaacccattccaaaagaggaagagcaaatgccggaagaaatctctgaa
aaagtgatactaaagaaaccaaaacaagaaagtctcaaggaagaactcgcagatgaagtg
acgattaagaaaccagttactgaagaaagaaaagaagatataaaagaaatcactgaagaa
gttacattgaaaaagaaaccaaagaagaagcctattacagaggaacttgcggctgaaata
actgtaaagaaacccgttttaaaaaaggaagagcaaatgccagaagaaatctctgaaaaa
ataatattaagaaaaccaaaagaaaaatctctcaaagaagaagttgccgacgaagtgaca
attaagaaactaattgtcgaagaaagaaaagaagatgtagttgaagaaattactttaaaa
cctaagtcaagaaaaaagatgttcgaaacagaagaaatgtcggaagtaactattgtgaaa
cctgtaaaagataagaaagtagatgaagaaattgcagaaacatctgcagatatattatta
agagaaaaagaatcagtaccagaaattgaagatgtaattacaaaggaattaactattcgg
aaaatcgagattatagaacaacctgaagaagtaattgaagaatttactttgaaacgcaaa
ccaccgaaaaaggctccgaaaccaattgaagaaatttatgaagatgttactttacgtaaa
ttacgaccaaagaaaaagtctagatcggatatcagagaagttactgaagtagagaatgta
acatttagaccacgttctacaaaaagaaaagaggatgtagaacaagaatttaaaatctcg
ttaaatacatatgaagaagaagatatttctatgtccggtaaagtacgtctaaaatcaaaa
agacggccgcttacatattctgaagagactggagaggaaacaatcaaaatcattcaagaa
atagaagattatccgattatcgaagaagtcatcaatgaatcggaagaagaagggaaagaa
gaatacagtatcgaagagcttgatattgacgaaatgaatataccgctaagacgaaagaaa
aagaaacaaaaaactccatatactgtagaagaaattgaagatgatgttaaattgcaattg
aatcgtgatagaaaatactcatacgaggaagccgatactgaatctttggcactgaagttg
aaaagcaagagacgtatttccactttcgaagaagaagaagcttctctcagtattactaaa
gaagaggaaatatccgaagaagtggaggaacttgaatatgttgttcgggaaggtgataca
atgttttcaatttgttcttatattgctgaaacagaagaagctattaatttagtagaagga
gaaaaaatttatattatcgatcatattaatcaggattggtggtttgtaaagaaacacttg
accgaagaaaaaggttgggtaccggcgcaatatttattggatgaagcacgttacactgtt
tacttgcaacgaaaattgcatgaaaagattgacaaattgccaatctttgagaagcctgcc
cccggagaaaaagcctcagcaccaagatttattgaaaaattacaaccaattcatacatta
gatggttacaccgtgcaattcgaatgtcaagtagaaggcataccaagaccacaaataacc
tggttccgccagactgctattatcaaaccatctactgattttcaaatatattatgacgag
gataacgttgctaccttgataatcaaggaagtctttcccgaagatgccggcacttttacc
tgcgttgcgaaaaatgctgcaggatttgcgtccagtactactgagcttattgtcgaagct
cctttgtcagatcacggatcagatgttactggtctctcgagaaaaagtctttcgagagaa
tcatctttagccgatatattagagggtataccacctacattttcccgaaagccgaaagcg
aaatatgtgaatgaaggtgacgatgtgatattagaatgtcgattggtcgctgtaccggaa
ccagaaataacatggcatcacaaagacataccagtaattagtcaacagaacgttattgtt
gcaactgaaagtgacatgcatatgtactgcagtgtcgtaaacttcactaaaattcaaaag
aagcaggagggaagatacaagattattgctaaaaacagagagggcgaggctactatcgat
attcctgtaaaggtaaaaactggaaagagcgaaccacctgaaattttagaaccgttacaa
tcctatatagttaaagaaggtgagactgttgtcttatcgactcaaatagtcggtaatcca
tcaccgaaaataacatggtacaaaaacgggaaaccattaaagggctcgcaattaaagcaa
gacggacatgttaacatattaaatttgatccaacctcaattagcagatagtggggaatat
tcggttacagctatcaatgatatgggcaaagctgagactcgggctacattgactgttgag
aaagtaccaagtggcgctccagaaccaccattattcaccaaacgtttccaagaagtaatt
gttccggaaaaagatacttttaagttagttgccaaagttactggtaatcccgttcccgaa
gttacttggcttagaaacaacaaaccgcttgataaatcggtcaatatcatagaaagttat
gatggtgagaacatcctacttgaaattaaaaatgcagactctgaagtcgatgctggagat
tataaatgcgtcgctagtaattcagtcggaaaagcttctcatggtgcaaaagtcacagta
gatgttgctaaagtttttttcacaaggaatttgcaaaatgaaatcatagtcaacgaatac
aaaactctagaattaagctgtgaaacatcccatactgtttctacgatgtggtggcacaat
gataaagaaattagcgggatggatcatcgcgagataattcaagaaggacgtctacacaag
ttacttattaagaagagtggtctttccgacgcaggaacatacaaatgtactgtcaagaac
caaatgacgtttagcaatgttatcgttaaggctaccaagccagaattcgtcaggaaattg
caagattttgaggtaaaagaacgcgatgtggcgattttagaggttgagattacatcccaa
acggccgatgtcacatggcgaaaagatgatgaattattaacaccaagcaaaggaaaacta
gaatttatgaaagatggtaccgtaagaaaacttttcatcagaaatacatcggttcacgac
gaaggcgaatacacatgcgctcttctagatcaagagtgtacagcagaagttacagttgtc
gaattaccaccagagatcattatcaaaatgcaagatataactatagctacaggagagaaa
gcgactttcgacatagaattaacaaaaggtgacgctctggtacgctggttcaaagacggg
caagaattgcaattttctgagcatgtgcgattgtcaatcgatggcaaaagacaaaaattg
aaaatttatgacactgaagtagaagatgcaggaatctattcctgtcaagttggtgatcaa
acttcgtcagccagattgacagtcgaagaatccgaagtagattttattaaaaaattacca
gatattactttagtacctctcaatattgatgcaacttttcttatcgaattatcacgtgcc
gatgtaccggtaacatggttaaagaaaaatgaaatgatcgattgtgcacaatcgtcgaaa
tataatgttatcgacgaaggaaatattaaaaagctcattgttaaaaaatgcacgaccgaa
gatatcgctgaatatactgctgcagttgccaatgtgaaaacgtcatcgagattaaaaatc
gaagttattgaaacatcgcctaaaattcatcctgatacgcttaaaaaatacaaaacaatg
aaaggcgatgacattgatattgttgtcaaattcgcggctaagccaattccaattgatgag
tggatcgtcaatggccgtattcttaaaaaatctaaacgaattattccatccattgatgaa
tgttcagccgtcttaataatcagagacgtacaagagaaagattgtggtgattatactcta
aaattaactaatccacatggagaggatagtatagaaatcaacgtcattgttgtgcaggta
cccggtgcaccaggaattccggaacctcttgaaataaccgatgatagcattactcttcat
tggaagaaaccagattcagatggacactcctcgatcatagaatacattttagaatatcga
gaaaagacagaaactttatggagcagaatcacggagacaataattgaaactacatataaa
ttaaccaacttaatctccgacaaggaatataccttccgtgtaacagctgttaacgaagct
ggaccaggggaagcatcgctgaatacgccatatctaagaatttccaagttatcagcgtct
gagccaccgaccgttcttgaagcacttaaaagtatcgtcattggattagaagagaccgtc
acactttcttgcgtaattggtggtgtaccaacacctcgtattacatggttgaaagatggc
aaggctttcgaagatagtgatattacatacgaaaaccatttagctaaatatactattcga
aaaactactgagacatcttcagccacatttacggttaaagctcaaaatgatgcaggaatg
gcggaaacatcatgtcaattaaaaattcaagaatctccaaagatcacttgcgatgaaaat
ttaagaaagcagagactaacagtgggcgataaatggaaagctgagattcattttagtggt
tttccaaaaccggaagtaacgtggacgataaataacaaaacaataattgataagcgcatt
tccattgagactaaggaaaatacatctattattatgatttcttcgcttgttagaaatgac
acagctatctatacagtgaaagcatcgaatgaagccggtagctcatcaatggaatgtcat
cttcgtgttatagataaaccaagtaaaccccagggaccagttatcgcgaaagaaattaga
caagatcgcgtcaccatagaatggcgaccgccgatcgatgatggtggtgttgaactggaa
agatataccattgagaagtgcgaaatgaataagaaagcttggacaaaagtaggtgatgtt
gacaaagaagttgagaatttctgtgtgcagaaattgcagcaagatgtcgactacctattc
agaatagttgctagaaactcggtcggatcctcagatcctttggaatccgaaccaattcga
acaagaacatcattcgaaataccgggtccaccgagaggaccactcgaagtttttggaatg
acgaaaacatcattcacattaaaatgggaaccaccaaagaatgatggcgggactcctatt
atagaatacattatcgaaatgaaggagacatctaagaaaacttggcaaagaattgcgagt
acaaagggggaagtcactaatgttactgtatccgatttaaaattggacacatcgtacaat
ttccgaataatagctaaaaataacgttggtactggtcctccatatacagcagaagaagtg
attacaaccggtaaacaaccgacaccaccttcgtgcccgctaaacgttcgagcaacaaat
gtcactagcaaaagcgtcactctcagttggtcaccaccaactacaacaggaggatcagaa
ttgacaggttatgtaatcgagaagagaccattaatcggaaaaggcgccaggtggtcaaaa
gttgtcactttggatgctacaacacaccaatattgtatagagaacctaaaagaaagcgaa
ttcctctttagaatctttgctgaaaatagtttaggtcttagcatacctactaattccgag
ccgatcacgctaaaaactcatgctaatgttccatcaccacctactgctccgttagagatg
agacagattgcagcgaatacaatggtaatcgaatggggtagacccgaatcagacggcggt
gcatctctcgagggttacaaaattgctattagagacgcgaagaaaactatgtggatggaa
gtgggaagagttagcgcggacatacaaaaattgaacattagagatctgcaagagaatcac
gaatatctcataagaatcttcgcacgaaatgagatcggatttagcgatcatttggaatcg
gaagaaccctttaagatcgtaccgacatcagaactatcgtgcgtggaactaattgcagag
gctatggacaaaggtgagaccgcatcaatcagctttagtacggaaaacacaagttcatgg
ttaagagaacataatatggatgccgatatacattcatacgcgagagcaagattacttagg
aaagatgagtactttttccgtatttggcactatgctaaaaagttgtttgaataa

DBGET integrated database retrieval system