KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105154369Help
Entry
105154369         CDS       T03917                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC105154369
  KO
K20027  palmitoyltransferase ZDHHC1/11 [EC:2.3.1.225]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aec04131]
    105154369
Enzymes [BR:aec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     105154369
Membrane trafficking [BR:aec04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105154369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 105154369
NCBI-ProteinID: XP_011068153
Position
Unknown
AA seq 628 aa AA seqDB search
MLNERCVNNNRIGRCCTTWRDTQPGYVPPEQRRFRRVHGLQLPLHPQQIVGWVLLTIVFV
GTFIVLLTLRTPPVLPDLRSVLSSLFAALFLLHLSSHLTVLLLDPADPEVRARPVRAIVP
EFDRAKHRHVIENGRCHLCNITTRGRRTKHCSICNKCVPRFDHHCKWLNNCIGGXAVTAL
ALGELVLVNAHLFVNNNWNNNGTWANASMNNGTATPPLLPVPDTGSLVLVTVIGILSAIA
AVMLIHLCFFHGYIACLGLTTYEYVRNKRERNTATAADSRTTSRTTSGLVAADEEDRVNR
IGARGLYSRFCENGPLRKTNTTSVTTDVYVCSTHPEETRNDEATANSIKDVSSKTRGGRN
FRLCFSYDSRTTETSIQVSSSQTTELRNHMRDSPDTKSSSTPSPVSCCFSIMNHPDAGSR
HDGNGRKRRTDRDNRIEPTKRSCGTMRRIQTFLQARLRKGSRQRLTTTGSSSAIARHCGN
KIIPQPGSPPDVALALTSAEHQARNVEARNVTMELTTPPDYPRPPARLPALDFSRTVRKV
RKVSSNTTDISVLGQMPPSTISKRNQTHLRTRRSGSFSKKRPHFKIGSHVVTQTAQLSPI
PESELSKPATPRSPSRSNSIFAFPPLHE
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacgagaggtgtgtaaataataataggattggccggtgctgcaccacctggcgg
gatacgcagccaggatacgtgccaccggagcagaggagattccggcgcgttcatgggcta
cagctgccactgcatcctcaacagatcgtcggttgggtactgctgactatcgtgttcgtc
ggtaccttcattgtgttgctgactctcaggacgccgccggtactgcccgacctgcgctcc
gtcctttcatcactgtttgccgcgttgtttctgctgcacctgtcgagccatctgacagtg
ttgctgttagatccggccgatcccgaggtacgcgcacgaccagttcgcgcgatcgtaccg
gagtttgaccgtgcgaagcatcgacatgtcatcgagaacggccgatgccacctttgcaac
ataacgacgcgtggtcggcgtaccaagcactgttccatctgcaacaagtgcgtaccgcgt
ttcgaccatcactgcaaatggttgaacaattgcatcggcggcntcgcggttaccgcgctc
gccctcggcgagctcgtgctcgttaacgcacacttattcgtcaacaataactggaacaat
aacggaacatgggcaaacgcgagcatgaataacggcacggcgacgccaccgttgttgccg
gtgcctgacaccggctcgctcgtcctcgtcaccgtcatcggtattctctcggccattgcc
gcggtgatgctcatacacctctgcttctttcacggctatatcgcctgcctcggtctcacc
acatacgaatatgtgcgcaacaaacgggagagaaacactgctaccgccgccgactctaga
acaacgtctagaacaacctctggcctggtagctgccgacgaggaggatcgcgtcaaccgg
attggcgcgcgaggtctctattctcgcttctgcgagaatggccctttacgaaaaactaat
actaccagcgtgactacggacgtgtacgtttgctcgacgcatcccgaggaaacccggaac
gacgaagcaacggcgaacagcattaaggatgtctcctccaagacgagaggtggccggaat
tttcgtctttgtttctcttacgattcgcgcaccaccgagacctctattcaggtctcttcc
tcgcagacgacggagttgaggaatcatatgcgtgactcgccggataccaaatcatcctcc
acgccctcgccggtgtcttgttgcttctccatcatgaaccatcccgatgccggcagcagg
cacgatggaaacggacgaaagcgtcgcaccgacagagataatagaatcgagcccacgaaa
cgatcctgcgggacaatgagaagaatacagacctttctgcaggctcgtctgaggaaaggc
tcgagacaacggttaacgacgacaggctcgtcctcagcgatcgctcgtcattgcggcaac
aagatcatcccgcaaccaggcagtcctccggacgtcgcacttgctttaacatcagccgaa
catcaggctcggaatgtcgaagcacggaatgtgacgatggaactgacgacaccaccggat
tatccacgtccaccggcgaggctacccgccctagatttttcccgcaccgttcggaaagtt
agaaaagtatcttcaaacaccactgatatttccgtcttggggcagatgccgccctccacg
atatctaaacgaaatcaaactcaccttcgcacacgacggagcgggagtttttccaagaag
agaccgcacttcaagatcggctcgcatgtcgtaacgcagaccgctcaactgtcgcccata
ccggagtcggagctttcgaaaccggctacgccgagatcgccgtcgcgatcgaattctata
ttcgccttcccaccattacacgagtaa

DBGET integrated database retrieval system