KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105154625Help
Entry
105154625         CDS       T03917                                 

Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aec01002]
    105154625
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aec03110]
    105154625
Enzymes [BR:aec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     105154625
Peptidases and inhibitors [BR:aec01002]
 Serine peptidases
  Family S8: subtilisin family
   105154625
Chaperones and folding catalysts [BR:aec03110]
 Intramolecular chaperones
  Subtilisin family
   105154625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 105154625
NCBI-ProteinID: XP_011068580
Position
Unknown
AA seq 1272 aa AA seqDB search
MADVIDCNFPVWGLLPKKETGVTQFLTKYPEYDGRGVVIAILDSGVDPGAPGMQVTSDGK
PKIIERFDCSGAGDVDTSKVVQAPDGYITGLTGRKLKVPSNWNNPSGEYHIGLKNLYSLY
PNKLKERVVAERKKRLWDDGHKAAFAEASRQLQEFENKNPQLSTLEERLQKEEFEARVEV
LNNIEKKYCDVGPTYDCVVFHDGNIWRACIDTSEVGNLETGVFLGEYSITRDFTPLTQED
QLNISINIHDEGNTLEIVSLCSSHGTHVASIAAAYFPDNPELNGVAPGAQIISLTVGDGR
IGTMETGTSVVRAMIHIMQRKEKVHVINMSYGEHAHWSNTGRIGELMNEVIDEYGVTWVA
SAGNLGPALCTIGTPPDISSNSIISVGAYVSPDMMVAEYSLREKMPGMPYTWSSRGPMID
GGAGVTVCAPGGAITSVPNFTLRKSQLMNGTSMASPHVTGAVAVLISGLLAKDSLYSPYS
IKRALENTALYVPNLDPFAQGSGLLQVERAFDNLISCCDAPERDVRFAVNCGVNNSKGIH
MRTGVIDRAKDFAITVEPVFINSENIDPARKIDFNLKLTLVCDASWVQFPTHLDLMHMPR
AFAIRVDATNLPEGVHATSVRAYDVTNIAKGPVFQIPVTVVQPMTIPKTALLPDLTYTNV
LFKPNTIQRHFILVPEDATWAVLRLKSTEKDKTGRFVMHTIQLKPRLACKTLEVNRIISV
TSQSETIQPFAVQGGLILEVVIAKYWANLGDMFIDYSIEFHGIHMINGNLTMLSGDGINR
LELRSSLRNEEIVPNISLKTSVQVLKPNESKIAPLRARDIIPPSRQIYELQLTYTFHSAK
STEVTPNAALLSDLLYESEYESQMWMIYDSNKQLISCGDAYPSKYTIHKLEKGDYTLKMH
IRHEKKDLLERLTDMPLLLSQKLSTPINLDIYANQSQAIIGGKKMVAACIPPGHILPLYI
TPLSNESNTENKVSKYATPGSYLQGTLTFCKDDIGKKVDSHVFKYIISEPAKKNVSPTAK
SEKEKTTKWDEYQEALRDLKCNYLAKFAPSIKPGDHTNTLYGELKGAFSDHLPVHTAMLI
SLDSSEARRHVPQNDLSENAIAFANQIITVADSVITNIDQDKLLAYYGLKNDQRPDAAKI
KVTMEKQKNSLIEGLVRKGCALARLYVHGTKTGEGDGSFEHLLESVTHHWQEVQKFAEPT
DNKVVILSLWHAHINNHYGRYLKLLTRYYEEKQLKEIDEKCIEIAKLLGWEHWSRLLTTS
IPTRYPATYRSF
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtcatcgattgtaactttcctgtttggggcctgctgcctaaaaaagagaca
ggtgtcactcagtttcttactaagtatccggagtacgatggacgaggtgttgtcattgcg
atactggactcgggggtggaccccggagccccgggtatgcaggtgacttcagatggaaaa
cccaaaattattgagagatttgactgtagcggagcaggggatgtagacactagcaaagtt
gttcaagcacctgatggatatataactggcctgactggtcgtaaattaaaggttccatct
aattggaataaccctagtggagaatatcatatcggtttaaagaatctgtattcattatat
cctaataaactaaaggaaagagtagtagcagaacgcaagaagcgtctttgggatgatgga
cataaagcagcatttgcagaagcctccagacaattacaggaatttgagaataaaaatcca
caattatcgactttggaagaaagactgcaaaaagaagagtttgaagctcgagttgaagta
ttgaataatattgaaaaaaagtattgtgatgtaggacctacttacgattgcgttgttttc
cacgatggtaatatttggagagcatgtattgatacttctgaagtgggtaacttagaaact
ggcgtttttcttggtgaatattctatcacgagagattttactcctcttacacaagaagac
cagttaaatattagtattaatattcatgatgaaggcaatacattggaaattgtcagctta
tgctcgagtcatgggacacatgtagcatcaatagcagctgcatattttcctgataatcca
gaattgaatggagtggcaccaggagcccaaattatttcgcttactgtcggtgatggtcgt
attggcacaatggaaactggaacttcagttgtgcgggcaatgatccatataatgcaacgt
aaagagaaggttcacgttataaacatgagttatggtgaacatgctcattggtcaaataca
ggtagaataggagaattaatgaatgaagttattgatgaatatggtgtaacatgggttgca
tctgctggcaatctgggcccagctttgtgtaccattggaactcctccagacatcagttca
aacagtattattagtgttggtgcttacgtatcacctgatatgatggtagccgaatattct
ttaagagaaaaaatgccaggcatgccatatacttggtcctcccgtggcccaatgatagat
ggaggtgctggtgtaacagtatgtgcaccaggaggtgccattaccagcgttccaaatttt
actcttagaaaaagtcaacttatgaatggtacgagtatggcaagtccacatgttactgga
gcagttgcggttcttatatcgggtcttcttgccaaagattctttatattctccttatagt
ataaaaagggcgcttgagaatactgctctttatgtacccaatttagatccatttgcacaa
ggctctggcctattacaagtcgaacgtgcatttgataatctcatttcgtgttgtgatgca
cccgaaagagacgtacgctttgctgtcaattgcggcgttaataattctaaaggcattcat
atgagaacaggtgtcattgatcgtgcaaaggattttgcaattacagtcgaaccagtattt
ataaatagcgaaaatatagatccagcacgcaaaatagattttaatctgaagctaacactg
gtgtgtgatgcttcctgggttcaatttccgacacatctggacttgatgcatatgcctcgt
gcttttgctattagggttgatgctactaatttaccagaaggtgttcatgctactagtgta
cgagcgtatgacgtaactaatatcgcgaaaggaccagtatttcaaattccggtaactgtt
gtccagccaatgacaataccgaagactgcacttcttccagacttaacatacacaaatgta
ttatttaaacctaatacaattcagcgtcattttattcttgttccagaagatgctacttgg
gcagttctcagattaaaaagcacagaaaaggataagactggtagatttgtgatgcacact
attcaattaaaacctcgtttagcctgtaaaactcttgaagttaacagaataataagtgtt
acatctcaatcggaaactattcaaccatttgctgttcagggtggattaattttagaagta
gttatcgcaaagtattgggcaaatcttggcgatatgtttattgattattctatagaattt
catggaattcatatgataaatggtaatcttacaatgctatctggagatggaataaatcgt
cttgaattacgtagctctcttagaaacgaagaaattgtacccaatatttctctgaagaca
tctgttcaagtcttaaagcctaatgaatcgaaaattgctcctttacgagcacgtgatatt
attccaccatcacgacaaatatatgaattacaactaacatacacattccactcggcaaaa
tcaactgaggtcacaccaaatgctgcattgcttagtgacttgttgtatgaaagcgaatat
gaaagccaaatgtggatgatttacgacagtaataaacaattgataagttgtggagatgca
tatccatctaaatatacaattcataaattagaaaagggagattatactttgaaaatgcat
atacgtcatgagaaaaaggatttgttggaaagattgacagacatgccgttactattgagt
caaaagcttagtacaccaattaatttggatatttatgccaatcaatcgcaagccattatt
ggtggaaaaaaaatggttgctgcatgtattccacctggccatattcttcctctgtatatt
actccactgtctaatgaaagcaacactgaaaacaaagtatccaaatacgctacccctggt
agttatcttcaaggtacattgactttctgtaaagatgatattgggaagaaggtggatagt
cacgtatttaaatatatcatatctgagcctgccaagaaaaatgtcagccctactgctaaa
tctgagaaagagaaaactacaaagtgggatgaatatcaggaagcattaagagatttaaaa
tgcaattaccttgctaaatttgcaccatcaataaaacctggtgatcacaccaatacattg
tacggagaattgaagggtgccttctcagatcatttgcctgtccacactgccatgttgata
tcgttggattcttcggaggcacggcgacatgtaccacaaaatgatctttcagaaaacgct
attgcgtttgctaatcaaataataacagttgctgactctgtgatcactaatattgatcaa
gataagttattagcatattatggattgaaaaacgatcagcgtcctgatgcggctaaaatc
aaagtaactatggagaagcaaaaaaacagtttgattgaaggattagtgagaaaagggtgt
gcattggcacgattgtatgtacatggaacaaaaactggagaaggagatggatccttcgaa
catttgcttgaaagtgttacacatcattggcaagaagtacagaaattcgctgaacctact
gacaataaggttgttattttatctctatggcatgcacacatcaataatcattatggacgt
tatttgaaattattgacacgctattatgaagaaaaacaattaaaagaaattgatgaaaaa
tgcattgaaattgcaaagcttctgggatgggaacattggtcacgtcttcttaccacaagt
ataccaacacgttacccagctacatatagatcattctga

DBGET integrated database retrieval system