KEGG   Alkalilimnicola ehrlichii: Mlg_0045
Entry
Mlg_0045          CDS       T00391                                 

Definition
(GenBank) Uncharacterized conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
aeh  Alkalilimnicola ehrlichii
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aeh02044]
    Mlg_0045
Secretion system [BR:aeh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mlg_0045
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABI55402
UniProt: Q0ACN5
Position
49079..49588
AA seq 169 aa
MSDQGTVAPRERINIRYVPATGDQASEAELPLKLLVVGDFKGGSEETPIEERTAVSVDKN
NFHSVLAESGLGLEACVPNRLQAGDEVSDLPVRLSFKALDDFAPDRLAQQVPELRKLVAL
REALVALKGPLGNIPAFRRQLQDLLESESVRERLLEELKRVTSPEDDTE
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtccgaccaaggaacggtcgcgcccagagagcgcatcaatatccgttatgtgcccgcc
accggagaccaggcgtccgaggccgagctgccactgaagctgctggtggttggcgacttc
aagggcggttccgaggagacgccgatcgaggagagaacggcggtctccgtggacaagaac
aactttcactccgtgctcgccgagtcgggcctgggcctggaggcctgcgtgcccaaccgg
ctgcaggccggtgacgaggtcagcgatctgcccgtccgcctctccttcaaggcgctggat
gactttgcccccgaccggttggcacagcaggtgccggaactccgcaagctggtggccctg
cgtgaggccctcgtggccctgaaagggccgctgggcaatatcccggcgttccgcaggcag
ttgcaggacctgctggagagcgagtcggtccgggaacggttgctggaggaactgaagcgc
gtcacgtcccctgaggacgacaccgagtga

DBGET integrated database retrieval system