KEGG   Alkalilimnicola ehrlichii: Mlg_0047Help
Entry
Mlg_0047          CDS       T00391                                 

Definition
(GenBank) protein of unknown function DUF1316
  KO
K11905  type VI secretion system protein
Organism
aeh  Alkalilimnicola ehrlichii
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aeh02044]
    Mlg_0047
Secretion system [BR:aeh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mlg_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ABI55404
UniProt: Q0ACN3
Position
51108..51536
Genome map
AA seq 142 aa AA seqDB search
MALSRSYPRGPRLFERLGGLPLDPGPSAADGGVLIESIKAHLADLLNSHPGHCACAPGLG
LVDFNDATLGALDLRLSIRRAVRDCIERYEPRIRQVSVEVMDQGSEPAALRFKLHAVLNT
DRGDQRTTLDLMLSDRHYRFID
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgtcccggtcctatccgaggggtccccggcttttcgagcgtctgggggggctg
ccgctggaccccggcccgtccgccgccgacggtggtgtcctgatcgaatcgatcaaggcg
cacctggcggacctgctcaacagccacccggggcactgcgcctgcgcccccgggctgggc
ctggtggacttcaacgacgccaccctgggggcgttggacctgaggttaagcatccggcgg
gctgtccgcgactgcatcgagcgctacgagccgcgtatccgccaggtgtcggtggaagtg
atggatcagggcagcgagccggccgcgctgcggttcaagctccacgcggtcctcaacacc
gatcggggagaccaacgcaccacgctggacctcatgctcagcgaccgtcattaccggttc
atcgactga

DBGET integrated database retrieval system