KEGG   Alkalilimnicola ehrlichii: Mlg_0048
Entry
Mlg_0048          CDS       T00391                                 

Definition
(GenBank) protein of unknown function DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
aeh  Alkalilimnicola ehrlichii
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aeh02044]
    Mlg_0048
Secretion system [BR:aeh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mlg_0048
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABI55405
UniProt: Q0ACN2
Position
51556..53319
AA seq 587 aa
MLNRYYRDELNFLRQEGRAFAQAYPHLSRFLSEPGDDPDVERLLEGFAFLTGRMREKVED
EFPELTHSLISMLWPNYLRPVPSMTIVRFDPRWHALRAGHRLPRGTALRSQPVQGTPCRF
RTSHDVTLYPLEVAGVDTARSRSRSQVTLRLAVHSDQPLADLPADPLRFYLGGDGYTART
LYLWLQHYLEGVDLEVAGERRSLPADAISPVGFERDQSLLPYPRNSFQGYRILQEYLCVP
DAFRFLDLQRLSAALPHEAADEIRLVFRFSRTLPRDARLSVDHFQLHCTPAVNLFEQDAD
PIDLTGERAEYPILPSSRNPAHYEVYSVDAVEGWLTTGSGRFRGEPRRYVPFESFQHQLE
RDRGGDARYYRLRVRESVRDDGFAHDIAFVREDEVYRLAHHETVSLRLTCTNRRLPESLG
VGDITDFADDSPALVTARNITRPTPALRPQLDGGLLWTLISNLALNYLSLLHTDALRSVL
RAYDFRALVDRQAERASQQRLAGIRAIDTVPVDRLHHGLPVRGMRSVVTLDEAAFGDEGG
LYQFGCVLARFLALYASINAFHELQVVNLRNQERYTWKWQPGQQPLM
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgctgaaccgctactaccgggacgaactcaacttccttcgccaggagggcagggcgttc
gctcaggcgtatccgcacctcagccgtttcctctcggagccgggggacgacccggacgtg
gagcggttgctggagggcttcgccttcctcaccggacgcatgcgcgagaaggtggaggat
gagttcccggagctcacccactcgctcattagcatgctctggcccaactatctgcgtccg
gtcccgagcatgaccattgtccgtttcgatccccggtggcatgcgttgcgtgccgggcac
cggctgccgcgcggcaccgcgctgcggagccagccggtacagggtaccccctgccgattc
cggaccagtcacgacgtcaccctgtatccgttggaggtggccggtgttgacaccgcccgt
tcacgcagccggtcccaggtgacgttacggcttgccgtgcacagtgatcagccgctcgcg
gacctgccggccgatccgctgcgtttctatcttggcggtgacggctatacggcgcgcacg
ctctatctctggctgcagcattatctggagggcgtggatctggaggtggccggcgagcgt
cgcagcctgccggcggacgctatcagtccggtcggcttcgagcgtgatcagtccctgctg
ccctacccgcgcaatagttttcaagggtatcgcatcctccaggaatacctctgtgtcccg
gacgcattccgtttccttgacttgcagcgcttgtctgccgccctgccccacgaggcggcc
gacgagatccggctggtgttccgtttctcacgcaccctgccgagggatgcccgcctgtcg
gtggaccacttccagctccattgcaccccggcggtcaacctcttcgagcaggacgccgac
ccgattgacctgaccggcgagcgtgccgagtacccgatcctgcccagtagccgtaacccc
gcccactacgaggtctatagtgtcgatgcggtggaagggtggctcaccacgggcagcggc
cggttccgcggcgagccccgccgttatgtgcccttcgagagcttccagcaccagctcgag
cgcgaccgtggaggggatgcgcgctactaccggctccgcgtacgggagagcgtgcgcgac
gacggcttcgcccacgatatcgccttcgtacgggaggacgaggtctaccggttggcgcac
catgagaccgtctccttgcgcctgacctgcaccaaccggcggttgcccgaatccctgggc
gtgggtgacatcaccgactttgccgacgacagccccgccctggtcacggcccgcaacatc
acccggcccacccctgccctcaggccgcaactggacggcggcctgctgtggacgctgatc
tccaatctcgccctgaactatctctcgctgttgcataccgacgcgctccgttcggtcctg
cgggcctacgattttcgcgcgttggtggaccgtcaggccgagcgcgcctcgcagcaacgc
ctggcgggcatacgggccatcgacaccgtgccggtggatcgtttgcaccacggcctgccg
gtgcgcgggatgcgctcggtggtaacgttggacgaagccgccttcggtgacgagggcggg
ctctaccagttcggctgcgtgctggcgcgctttctggcgctgtacgccagcatcaacgcc
tttcacgagctgcaggtcgtcaatctcagaaaccaggagcgctacacatggaagtggcag
cccggtcagcaaccgctgatgtga

DBGET integrated database retrieval system