KEGG   Alkalilimnicola ehrlichii: Mlg_0052
Entry
Mlg_0052          CDS       T00391                                 

Definition
(GenBank) protein of unknown function DUF876
  KO
K11893  type VI secretion system protein ImpJ
Organism
aeh  Alkalilimnicola ehrlichii
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aeh02044]
    Mlg_0052
Secretion system [BR:aeh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mlg_0052
SSDB
Motif
Pfam: T6SS_VasE CCAP Penicil_amidase
Other DBs
NCBI-ProteinID: ABI55409
UniProt: Q0ACM8
Position
55586..56923
AA seq 445 aa
MVCRNRVVWREGAFIKPHHFQQQQRSLEGLLDLRLQAVSGYSHGFLQLELNSEFLGFGRI
ALTRARGIMPDGTAFDLPGDDLEPPPLAVDEAGMANQRVYLGLPLAGDGVAEVSDEDAIR
DDGRYRLHRREIWDLHTSPGDVAELAVARAAPRLLLEHDDRSGYACLAVARILERRPDGS
LVLDPDFIPTTLTTRVAPGLQRFIGEVAGLMQARARRIAQRLAAPQQAGVADVSDFMLLQ
LLNRLQPRFQHLQQHRRLHPEALYSHMLEACSELATFTDESRLPRRYPPYDHDAPDTAFR
ALMQGLRQALSTVLEARAVAIPLEARRHGLMLAPLSDSTLLDEAEFVVAVRADMAVETLR
RQFIQQTKIAGIERIRDLVSLQLPGIPLVPLPVAPRQLPYHASHIYFQLDRRSEAWGLLT
GASGFAFHLGGDFPGLDLQFWAIRS
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggtctgccgtaaccgagtcgtttggcgtgaaggggcgttcatcaaaccgcaccacttc
cagcaacaacagcgcagcctcgaggggctgctggacctgcggctgcaggcggtcagcggc
tacagccacggcttcctgcaactggaactgaacagcgaattcctgggcttcggccggatt
gcgctcacccgggcccgcggcatcatgccggacggcaccgccttcgacctgccgggcgat
gacctggagccaccaccactggccgtggacgaggccggcatggccaaccagcgggtctac
ctggggctgcccctggccggtgatggcgtggccgaggtcagcgacgaggacgccatcagg
gatgatggccgctaccgcctgcatcgccgggagatctgggatcttcacaccagtcctgga
gatgtcgctgaactggcggtggcccgcgccgccccgcgcctgctgttggagcacgatgac
cgcagcggttatgcctgcctggcagtggcgcggatactggagcggcgcccggatggttca
ctggtactcgatcccgactttatccccaccaccctgaccacccgggtggcgcccggcctg
cagcggttcattggtgaggtggccgggttgatgcaggcgcgagcgcgtcggatcgcacag
cggctggccgctccgcagcaggccggggtggctgatgtctccgacttcatgctgctgcaa
ttgctgaaccgcctgcagccccggttccagcacctgcaacagcaccggcggctgcacccg
gaggccctctacagccacatgctggaggcctgcagcgaactggcgaccttcaccgacgag
tcgcggttgccccggcgctatcctccctacgaccacgatgcccccgataccgccttccgt
gcgctcatgcaggggctccgtcaggctctctccaccgtgctggaggcccgagcggtggcc
attcccctggaggcccgccgtcacgggctcatgctcgcgccgctaagcgattcgacgctg
ctggacgaggccgagttcgtggtcgccgtgcgcgcggacatggcggtggagacgctgcgc
cgacagttcatccagcagacgaagatcgccggtatcgaacgcatccgcgacctggtcagt
ctgcaactgcccggcattccgctcgttccgctgccggtcgcgccgcgccagctcccctat
cacgcgagtcatatctacttccagctcgaccgtcgcagcgaggcctggggcctgctgacc
ggtgcgagcggtttcgccttccacctgggtggtgacttcccagggctggatctccagttc
tgggcaataaggagttga

DBGET integrated database retrieval system