KEGG   Alkalilimnicola ehrlichii: Mlg_0057Help
Entry
Mlg_0057          CDS       T00391                                 

Definition
(GenBank) ImcF domain protein
  KO
K11891  type VI secretion system protein ImpL
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mlg_0057
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aeh02044]
    Mlg_0057
Secretion system [BR:aeh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mlg_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C AAA_16 DUF896
Motif
Other DBs
NCBI-ProteinID: ABI55414
UniProt: Q0ACM3
Position
61425..65042
Genome map
AA seq 1205 aa AA seqDB search
MSDKARNRVAGRLRGTMGSVTGGRVSRYSGWVGALRRGWPWVVGLLGIALLAVVWIWGPA
WQIGGARPLAPWPNRLLVILCAVLVVLVIIGLRLRARLRDAEPPRDEAEIPDPVAQATAG
QEQGLNHCLDQLRRQRGRHALQALPWYLVLGPEGSGKTSLVQRSGQRFSLTRSLHPQGGE
ASDSGLRCWASDRAVTLEPGAAWLLQGGWDRDGADALSASLWQHLVGWLQRRRPRRPLDG
VLLVLDLSRLTSAGARDDWGDALRERLQELTTTYQSRLPVYVVFSQMDRLYGFDAFFRHA
VGDARCEPWGFSFSAGSLADPDAWEEEFTGAYRRMLGRIERQLVAWLAACRDQGEREALF
RFSRQLAGLEPLLSETLQRVLGSRRYAVEPLVRGVYFASLGQQGVPIDAFADAATARYRL
PDLVHRARRNGQQSLAWFSERLLQRVVFPEAGLAGDSLRFVRRRRWLRGAGLVFSLAGLS
GLVIGWGHYYQHNLVALQAVEARAEALADLRPAQEHLDDPSGQHLVPALDELREVAGVFD
GPRGAWAGLADMGLYQGHRVGDAMDQAYLDALRYRFLPALMLGIADEMNTLAPGSEEQLV
RLRVLRMLADARGREPDRVRDYMADRWQALLPNRGRLQGRLLEHLDHALVHTDLAGRQAH
DPRAAAALAPVAGSIRKAQQAFSRSPVDERVYTLLKRRGQDRAGGGVRLDRSVGSGWGTV
FRADDDDPDGVTVSPLLTRDGFEQVFLGELDGATVLALNDLWVLGERDDPQFSERDEQRL
REALREQYVADFHAGWRRALGNIHLTDLESIPHAVIVIDALLGGGRPLERLLAEIERHTR
LYPELPVDDDVARDRLRGSSRYRLAGKLAAPFQPLHALHRKGEEADGDLAAVRAALGALR
DHLRAVEQSSEPGRIAYRHARNRLLQDSGDPVDRVERLAEELPAPLDGFMAGIAEQSWRL
ISGEAIRYLEQQWLDEVIAPFEADLAGRYPLEPNARREVALEDFERFFAAGGTLDSFFMD
KLQPFLDEAPELLEGPDGRSLLNPRLRTALERAERIREAYFGRDGLLDVGFTLAPVSLSG
DKRRSVLNVDGQILEYRHGAPQRVAMLWPNSLRQTNESGITLVPDRVNRSPRSERHQGAW
AWFRLLDEARVVAVGERELRLSFQVDGGEMSYRLTADRTRNPFTRPLTRGYTVPATLYRN
GVGGR
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacaaggcaaggaatcgcgtggcaggacgcctgcgcggcaccatgggcagcgta
acgggagggcgggtcagccgctattcggggtgggtgggcgcgctccgtcgcgggtggccc
tgggtcgtggggctgctggggatagcattgctggcggtggtctggatctgggggccggcc
tggcagatcggtggcgcccggcccctggccccctggccgaaccggctgctggtcattctc
tgcgcggtgctggtcgtgctggtgattattgggctccgcctcagggcccgcctgcgcgat
gccgaacccccccgcgacgaggctgagatccccgacccggtggcccaggcaaccgccggg
caggagcagggcctgaatcattgcttggaccagttgcggcgccagcgcgggcgccacgcc
ctgcaggcattgccctggtacctcgtgctgggtccggagggcagcggcaagaccagtctg
gtgcagcgctcgggccagcgcttttcactcacccggagcctccacccgcagggcggtgag
gcctcggatagcgggctgcgctgctgggccagtgaccgggccgtcacgctggagcccggc
gccgcctggctgttgcaaggggggtgggacagagacggtgcggatgccctgagcgcctcc
ctctggcagcacctggtcggctggctgcagcggcgtcgcccccgacggccgctcgacggc
gtgctcctggtgctggacctgtcccggctcaccagcgccggcgcccgggacgactggggc
gatgccctgcgcgaacgcctgcaggagctgaccacgacctatcagagccggcttccggtc
tacgtggtcttcagccagatggatcggttgtacggctttgacgccttcttccggcacgct
gtcggtgatgcccgctgcgagccatggggcttctccttcagcgccggcagcctggccgac
ccggacgcctgggaggaggagttcaccggcgcctaccgacgcatgctcggccgcatcgaa
cggcaactggtcgcatggctggccgcgtgtcgtgatcagggcgaacgggaggcccttttc
cgcttctcccgacagctggccggtctcgagcccctcctgagcgaaaccctgcaacgggtg
ctcggcagccggcgttatgccgttgaaccgctggtgcgcggggtgtacttcgcctcgctc
ggccagcagggggtgcccatcgatgcctttgccgacgcggccaccgcccgctatcgcctg
cccgacctggtgcaccgtgcccgccgcaatggccagcagtcgctggcctggttctcggag
cggttgctgcagcgggtggtcttccccgaggccggccttgccggggacagcctccgcttc
gtccgccgccggcgttggctgcgcggtgccggcctggtgttctccctggcagggctgagc
ggattggtcatcggctgggggcactactatcagcacaatctcgtggccctgcaggccgtg
gaggcgagggcggaggccctggcggacctgcgaccggcgcaggagcacctcgacgacccc
agcggccagcacctggtgccggcgctggatgagctccgcgaggtcgccggcgtctttgac
ggaccccgcggggcgtgggcaggcctggcggatatggggctctaccaggggcacagggtc
ggtgatgccatggaccaggcgtacctggacgcgctccgctaccggttcctgccggccctg
atgctcggcattgccgacgagatgaacacgctggcaccggggagcgaggagcagctcgtc
cggctccgcgtcctgcgcatgctcgccgatgcccgcggacgggaaccggatcgggtgcgg
gactatatggccgatcgctggcaggcgctgttgcccaaccgggggcggctgcagggccgg
ctgctggagcacctggaccatgccctcgtccataccgacctggcgggccggcaggcgcac
gatccccgcgcggcggccgcgctggcgccggtggccggcagcatccggaaggcccagcag
gcgttctcccgcagtccggtggatgagcgggtctataccctcctgaagcgccgcgggcag
gaccgagccggtggcggcgtaaggctggaccgcagcgttgggtcgggttggggcacggtc
ttccgcgccgatgacgatgatccggacggggtgaccgtatcgccgctgctgacccgtgac
ggctttgagcaggtctttctcggagagttggacggcgccacggtcctcgccctgaacgac
ctctgggtgctgggcgagcgggacgacccgcagttcagcgagcgcgacgagcagcgcttg
cgggaggccctgcgtgagcagtatgtggccgacttccacgccggttggcgccgagccctg
ggtaacatccatctcaccgatctggagagtattccccacgccgtgatcgtcatcgacgcg
ctgctggggggcggccgtccgctggaacgcctgctggccgagatcgagcgccacacccga
ctctaccccgaactcccggtggatgacgacgtggcccgggaccggctcaggggctcgtcg
cgctaccggctggccgggaagctggccgcgcccttccaacccctccacgccctgcatcgg
aagggggaggaggcggacggcgatctggccgccgtccgggccgcactgggggcattgcga
gaccatctgcgggcggtggagcagtccagcgagccggggcgcatcgcctaccgtcacgcc
cgcaaccggctactgcaggacagcggggatccggtggaccgggtggagcggctggccgaa
gagttgcctgccccgttggatggattcatggcgggtatcgccgagcagagctggcggctg
atcagtggtgaggccatccggtacctggagcagcagtggctggacgaggtgattgccccg
tttgaggcggatctggccggccgttacccgctggaaccgaacgcccggcgggaggtggcg
ctggaggacttcgagcgcttctttgcggcgggcggcaccctggacagcttcttcatggac
aaactgcagcccttcctcgacgaggccccggaactgctggaggggcccgacgggcgttcg
ctgctcaatccccggttgcggacggcgctggagcgggcggagcggatccgggaggcctac
tttggccgggacgggctgctggatgtcggtttcaccctggccccggtgagcctcagcggt
gacaagcggcgtagcgtgctcaacgtggacgggcagattctggagtatcgccacggcgcc
ccccagcgggtcgccatgctctggcccaacagcctgcgtcagaccaatgaaagcgggatc
acgctggtacccgaccgcgtcaaccgttcgccgcgcagcgaacgccaccagggggcctgg
gcctggttccgcctgctcgacgaagcccgtgtggtggcggtgggcgagcgggagctgcgg
ctcagcttccaggtggatggcggggagatgagctaccgcctgaccgcggaccggacccgc
aatccgttcacccggccgctgacccgggggtacacggtgcctgccaccctgtaccgcaac
ggggtcggcggacgctga

DBGET integrated database retrieval system