KEGG   Alkalilimnicola ehrlichii: Mlg_0166Help
Entry
Mlg_0166          CDS       T00391                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00970  Aminoacyl-tRNA biosynthesis
aeh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mlg_0166
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aeh03029]
    Mlg_0166
Enzymes [BR:aeh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Mlg_0166
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Mlg_0166
Mitochondrial biogenesis [BR:aeh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mlg_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABI55521
UniProt: Q0ACB6
Position
complement(196445..197881)
Genome map
AA seq 478 aa AA seqDB search
MEWETVIGLEIHAQLATKSKIFSGAATAYGAEPNRQACAVDLGMPGVLPVLNKGAVRMAT
KFGLAIGAKIAPRSVFARKNYFYPDLPKGYQISQYELPIVEGGELWIELEDGERKRIGVT
RAHLEEDAGKSLHEDFHGMTGVDLNRAGTPLLEIVSEPDLRSAAEAAAYMKKLHALVRYL
EICDGNMQEGSFRCDANVSVRPKGEEKFGTRAELKNLNSFRFVERAINYEVERQIALIES
GGTVVQETRLYDADKGETRSMRTKEEANDYRYFPDPDLLPVELDPTFIEEVRETLPELPD
EKRARFVEEYGLSDYDAGVLTATRELAEFYESVVTESGGFAKRSANWVQGDFLGALNKAG
LELADSPVTPEMLGRLVARIEDETISGRVAKEVFEAMWNGEGEPDQIIEAKGLKQVTDTG
AIEAMIDEVLAANPKQVEQYKGGKDKLLGFFVGQVMKASRGKANPGQVNELLKEKLDS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggaaacggtaatcgggcttgagattcacgcccagctcgccaccaaaagcaaa
atcttctccggtgcggccaccgcctacggtgccgagcccaaccgccaggcctgcgcggtg
gacctgggcatgcccggggtgctgccggtactgaacaagggcgcggtgcgcatggccacc
aagttcggcctggccatcggcgccaagatcgccccgcgctcggtgttcgcgcgcaagaac
tacttctaccccgacctgcccaagggctaccagatcagtcagtacgagctgcccatcgtg
gagggcggcgaactgtggatcgagctggaggacggcgagcgcaagcgcatcggcgtcacc
cgcgcccacctggaggaggacgccggcaagtcgctgcacgaggacttccacggcatgacc
ggagtggacctcaaccgcgccggcaccccgctgctggagatcgtctccgagccggacctg
cgcagcgccgccgaggccgcggcctacatgaagaagctgcacgcgctggtccgctacctg
gagatctgcgacggcaacatgcaggagggctcctttcgctgcgacgccaacgtctccgtc
cggcccaagggcgaggagaagttcggcacccgcgccgaactgaagaacctcaactccttc
cgctttgtggagcgcgccatcaactacgaggtggagcgccagatcgcgctgatcgagtcc
ggcggcacggtggtgcaggagacccgcctgtacgacgccgacaagggcgagacccgctcc
atgcgcaccaaggaagaggccaacgactaccgctacttcccggaccccgacctgctgccg
gtggagctggacccgacgttcatcgaagaggtccgcgagaccctgccggagctgccggac
gagaagcgggcccgcttcgtcgaggaatacggcctgtccgactacgacgccggcgtgctc
accgccacccgtgagctggccgagttctacgaatccgtggtgaccgagtccggcggcttt
gccaaacgcagcgccaactgggtgcagggcgacttcctgggcgcgctcaacaaggccggc
ctggagctggccgacagccctgtcaccccggagatgctcggccggctggtcgcccgcatc
gaggacgagaccatctccgggcgcgtggccaaggaggtgttcgaggccatgtggaacggc
gagggcgagccggaccagatcattgaggcgaagggcctcaagcaggtcaccgacaccggt
gccatcgaggccatgatcgacgaggtgctggcggccaaccccaaacaggtggagcagtac
aagggcggtaaggacaagctgctgggcttcttcgtcggccaggtcatgaaggcctcccgc
ggtaaggccaacccggggcaggtcaacgagctgctgaaggaaaagctcgacagctga

DBGET integrated database retrieval system