KEGG   Alkalilimnicola ehrlichii: Mlg_0270Help
Entry
Mlg_0270          CDS       T00391                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00010  Glycolysis / Gluconeogenesis
aeh00020  Citrate cycle (TCA cycle)
aeh00620  Pyruvate metabolism
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01200  Carbon metabolism
Module
aeh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlg_0270
   00020 Citrate cycle (TCA cycle)
    Mlg_0270
   00620 Pyruvate metabolism
    Mlg_0270
Enzymes [BR:aeh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mlg_0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 HlyD_3 DUF2118 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ABI55625
UniProt: Q0AC12
Position
309952..311649
Genome map
AA seq 565 aa AA seqDB search
MADVKEVRVPDIGDFAEVDVIEVLVAPGDRIEKEQSLITLESDKASMEVPSSEAGVVKEV
KIKVGDKVSEGDVVVLVEAEEGGDSPAEAPTGSDAGASAPAAGGSDAPAAGGGEAVQVKV
PDIGDFAEVDVIEVLVSPGDTVEQEQSLITLESDKASMEVPSSHAGVVKEVKVKVGDKVS
EGDTVAVLESQGAGGGATASAPAKEAGEAAKPSQEPAETYAADSQREAAAPESYKANAYL
LTDSRPPQAPPPIDREAHRRAHASPAVRRFARELGVDLGQLQGRGSGRKGRILKEDVQAY
VKQALAGGGAAAAPAGQAGGAGIPPIPEVDFSKFGEVERQPLSRIQKLSGPHLQRSWLNV
PHVTQFDEADITELEAFRKSMKTEAEKAGVKLTPLAFMVKASAAALRAFPRFNSSLAPAG
DELILKKYVNIGVAVDTPNGLVVPVIRDADRKSVYQIAEDLGTLSAKARDGKLGPSDMQG
GCFTISSLGGIGGTAFTPIVNAPEVAILGVSRSSMKPVWNGSEFEPRLMLPLSLSYDHRV
IDGAAGARFTAWLAQALGDIRRLLL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtcaaagaagtccgcgtccccgatatcggtgatttcgccgaggtggacgtg
attgaggtgctggtcgcccccggcgaccggatcgagaaggagcaatcgctgatcaccctg
gagtcggacaaggcctccatggaggtgccctccagtgaggccggggtggtcaaagaggtc
aaaatcaaggtgggcgacaaggtctccgagggggacgtggtcgtcttggtggaggccgag
gagggcggtgattcgcccgccgaggccccgacgggcagcgacgccggggcgtccgcccca
gccgccggcggttccgatgccccagccgccgggggcggtgaggccgtccaggtgaaggtt
ccggacattggtgatttcgccgaggtggatgtcattgaggtgctggtcagccccggtgac
acggtggagcaggagcagtcgctgatcaccctggagtcggacaaggcctcaatggaggtg
ccttcgagccacgcgggcgtggtcaaggaggtcaaggtcaaggtgggcgacaaggtctcc
gaaggggatacggtcgccgtgctggagagccagggtgccggtgggggtgccacggcctcc
gcgccagccaaggaggcaggggaggcggcaaagccgtcccaggagccggccgagacctac
gccgctgacagccagcgcgaggccgcggcgccggagagctacaaggcgaacgcctacctg
ctcaccgactcccgtccgccccaggcaccgccgcccatcgaccgcgaggcccatcgccgc
gcccacgccagcccggcggtccgccgcttcgcccgtgagctgggcgtggatctgggccag
ttgcagggcaggggctcgggccgcaaggggcgcatcctcaaggaggacgtccaggcctac
gtcaagcaggccctggcggggggcggagcggccgcggcaccggccgggcaggccggtggc
gccggcatcccgcccatccccgaggtggacttcagcaagttcggcgaggtggagcgccag
ccgctctcgcgcatccagaagctctccgggccgcacctgcagcgctcctggctcaatgtg
ccccacgtcacccagtttgacgaggcggacatcaccgaactggaggccttccgcaagtcg
atgaagaccgaggcggaaaaggccggggtcaagctgaccccgctggccttcatggtgaag
gcctccgcggcggcgctgcgggccttcccgcgcttcaacagcagcctggcgccggccggt
gatgagctgatcctcaagaagtacgtgaacattggcgtggcggtggatacccccaatggc
ctggtggtaccggtgatccgcgatgccgaccggaagagcgtctaccagatcgccgaggac
ctgggcacgctctctgccaaggcgcgtgacggcaagctggggccgtcggacatgcagggc
ggttgcttcaccatttccagcctgggcggcatcggcggtaccgccttcacgcccatcgtc
aatgcgcccgaggtggccatcctcggggtctcccgctcgtccatgaagccggtctggaac
ggcagcgagttcgagccgcggttgatgctgccactgtcgctgtcctacgaccaccgggtg
attgacggcgccgccggcgcccggttcaccgcctggctggctcaggccctgggcgacatt
cgccggctgttgctgtaa

DBGET integrated database retrieval system