KEGG   Alkalilimnicola ehrlichii: Mlg_0423Help
Entry
Mlg_0423          CDS       T00391                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00670  One carbon pool by folate
aeh00790  Folate biosynthesis
aeh01100  Metabolic pathways
Module
aeh_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mlg_0423
   00670 One carbon pool by folate
    Mlg_0423
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mlg_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ABI55777
UniProt: Q0ABL0
Position
complement(473184..473684)
Genome map
AA seq 166 aa AA seqDB search
MSPRPEITLIAALADNGVIGRDNDLPWRIPADLKRFKARTQGRPLIMGRRNYESIGRPLP
GRHNIVLTRRRDWQAEGCTVVHDPEAALAAAGDVEEVMVIGGEEIYRLFLPRADRLELTR
VHTEVPGDTFFPDIDPADWQVVAEQQPPSEETNDWPLTYQTLERRR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagcccacgccccgagatcaccctcatcgccgccctggccgataacggcgtcatcggc
cgcgacaacgacctgccctggcgcatccccgccgacctgaagcgcttcaaggcccgcacc
cagggccgccccctcatcatgggccggcgcaactacgagtccatcggccgccccctgccg
ggccgccacaacatcgtgctcacccgtcgccgggactggcaggccgagggctgcaccgtg
gtccacgaccccgaggccgcgttggcggccgcgggcgacgtggaagaggtgatggtgatt
ggcggcgaggagatctaccgcctcttcctaccccgggccgaccgcctggaactcacccgg
gtccacaccgaagtgcccggcgacaccttcttccccgacatcgaccccgcggactggcag
gtcgtcgccgagcagcagccccccagcgaagaaaccaacgactggcccctcacctaccag
accctggagcgccgccgctga

DBGET integrated database retrieval system