KEGG   Alkalilimnicola ehrlichii: Mlg_0591Help
Entry
Mlg_0591          CDS       T00391                                 

Definition
(GenBank) methenyltetrahydrofolate cyclohydrolase / 5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00670  One carbon pool by folate
aeh01100  Metabolic pathways
aeh01120  Microbial metabolism in diverse environments
aeh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Mlg_0591
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     Mlg_0591
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     Mlg_0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: ABI55945
UniProt: Q0AB42
Position
complement(642915..643775)
Genome map
AA seq 286 aa AA seqDB search
MSAQILDGKAIAAELREQVRKQVEARVERGGRRPGLAVVLVGADPASTVYVGKKRQACEQ
LGMHSSAHELPAETTQDELLALVDELNGRDEIDGILVQLPLPDHIDEQTVIDRIHPDKDV
DGFHPVNMGRLTLRLPGLRPCTPNGVMTMLAHAGIELEGKDAVIIGQSNIVGRPMAMELL
NARCTITICHSRTRNLADRVRAADIVVAAVGRPGFVPGDWIKPGAVVIDVGINRLESGKL
TGDVDFAAARELAGWITPVPGGVGPMTVATLMANTLAAAEARDSRA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacagattctggatggtaaggccatcgccgcagaactacgggagcaggtacgc
aagcaggtggaggcccgtgtcgaacggggcggacggcgcccggggctggccgtggtcctg
gtgggggcggacccggcgtccaccgtctatgtgggcaagaagcgccaggcctgcgagcaa
ctgggcatgcactccagcgcccacgaactacccgcagagaccacccaggacgagctgctc
gccctggtggacgagctgaacggccgtgacgagatcgacggcatcctggtgcaactgccc
ctgcccgatcacatcgacgagcagacggtcattgaccgcatccacccggacaaggacgtg
gacggcttccatccggtcaacatgggccgcctgaccctgcgcctgcccggcctgcggccc
tgcaccccgaatggggtaatgaccatgctcgcgcacgcgggcatcgagttggagggcaag
gacgcggtgatcatcggccaatccaacatcgtcggccggcctatggcgatggagctgctc
aacgcccggtgcaccatcaccatctgccacagccgcacgcggaacctggccgatcgggtg
cgggccgccgacatcgtggtggccgcggtgggccggcccggcttcgtccccggcgactgg
atcaagcccggggcagtggtcattgacgtgggtatcaaccggctggagtccggcaagctc
accggcgacgtggacttcgccgctgcccgcgagctggccggctggatcaccccggtgccg
ggtggcgtcggcccgatgactgtggccaccctgatggcgaataccctggccgccgccgag
gcccgtgacagccgcgcctga

DBGET integrated database retrieval system