KEGG   Alkalilimnicola ehrlichii: Mlg_0688Help
Entry
Mlg_0688          CDS       T00391                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00071  Fatty acid degradation
aeh00280  Valine, leucine and isoleucine degradation
aeh00310  Lysine degradation
aeh00362  Benzoate degradation
aeh00380  Tryptophan metabolism
aeh00620  Pyruvate metabolism
aeh00630  Glyoxylate and dicarboxylate metabolism
aeh00640  Propanoate metabolism
aeh00650  Butanoate metabolism
aeh00900  Terpenoid backbone biosynthesis
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01200  Carbon metabolism
aeh01212  Fatty acid metabolism
aeh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mlg_0688
   00630 Glyoxylate and dicarboxylate metabolism
    Mlg_0688
   00640 Propanoate metabolism
    Mlg_0688
   00650 Butanoate metabolism
    Mlg_0688
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mlg_0688
   00072 Synthesis and degradation of ketone bodies
    Mlg_0688
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mlg_0688
   00310 Lysine degradation
    Mlg_0688
   00380 Tryptophan metabolism
    Mlg_0688
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mlg_0688
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mlg_0688
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mlg_0688
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aeh04147]
    Mlg_0688
Enzymes [BR:aeh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mlg_0688
Exosome [BR:aeh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mlg_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABI56042
UniProt: Q0AAU5
Position
763202..764389
Genome map
AA seq 395 aa AA seqDB search
MSDREVVVLSAARSAIGTFGGTLAGFEPADLGGLIIKEAVARSGVDPNQINYTTVGNCIP
TESRSPYVARVAAVQGGLPHNSTAVTVNRLCGSGMQAIVSTAQSILLGDADFGVGAGTEV
MSKGGYLTPSARFGARMGDAKMVDMMVATLTDPFGVGHMGITAENLAEKWNISREEQDQF
AAESQRRAQAAIEGGYFKDQIVPVTIKSRKGEKVFDTDEHPRFGVTVEDLAKMRPAFKKE
GGTVTAGNASGINDAAAALVLADRAAAEKAGHKPVARMVAYGIAGVPNDIMGEGPIPSSK
VALDKAGLSIEDMDVVESNEAFAAQALTVMKGLGLDPAKTNVNGGAIALGHPVGATGSIL
AVKAIHELHRIQGKYALVTMCIGGGQGITAIFERM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacagagaagtggttgtccttagtgcggcacgttccgccatcggtacctttggc
ggcaccttggccgggttcgagcccgctgacctgggtggcctgatcatcaaagaggcggtg
gcgcgctccggtgtcgaccccaatcagatcaactacaccaccgtgggcaactgcatcccc
accgagagccgctcgccctatgtggcccgggtggcggcggtgcagggtgggctgccgcac
aactccacggcggtcaccgtcaaccggctgtgcggctccggcatgcaggccatcgtctcc
accgcccagtccatcctgctgggcgatgccgacttcggtgtcggtgccggcaccgaggtg
atgtccaagggcggttacctcaccccctcggcccgtttcggcgcccgcatgggggatgcc
aagatggtcgacatgatggtggccaccctgaccgaccccttcggcgtcggccacatgggc
atcaccgccgagaacctggccgagaagtggaacatctcccgcgaggagcaggaccagttc
gccgcggagtcccagcgccgtgcccaggcggccatcgaaggcggctactttaaggaccag
atcgtgccggtgaccatcaagagccggaagggcgagaaggtctttgacaccgacgagcac
ccgcgctttggtgtcaccgttgaggatctggccaagatgcgcccggccttcaagaaggag
ggcggcaccgtgaccgccggcaacgcctccggtatcaacgatgccgctgccgccctggtg
ctggccgaccgtgccgcggccgagaaggccggtcacaagcccgtggcgcggatggtggcc
tacggtattgccggggtgcccaacgacatcatgggggaggggccgatcccgtcgtccaag
gtggcgctggacaaggccggactgagtatcgaggacatggacgtggtggagtccaacgag
gccttcgcggcccaggcgctgacggtcatgaagggcctggggctggacccggccaagacc
aacgtcaacggcggcgccatcgccctgggccacccggtgggggccaccgggtccatcctg
gcggtcaaggcaatccacgagctgcaccgcatccagggcaagtacgccctggtcaccatg
tgcatcggtggcggtcagggcatcacggccatcttcgagcgcatgtga

DBGET integrated database retrieval system