KEGG   Alkalilimnicola ehrlichii: Mlg_1237Help
Entry
Mlg_1237          CDS       T00391                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00260  Glycine, serine and threonine metabolism
aeh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01130  Biosynthesis of antibiotics
aeh01230  Biosynthesis of amino acids
Module
aeh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlg_1237
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlg_1237
Enzymes [BR:aeh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mlg_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ABI56586
UniProt: Q0A9A1
Position
1441888..1442712
Genome map
AA seq 274 aa AA seqDB search
MNRLEKRMSACRKAGRKALIPYITAGDPGPEHTVPLMHALVGAGADVLELGVPFSDPMAD
GPVIQAACERALAHGTTLRDVFDMVRRFREQDGETPVVLMGYLNPVEYLGPAVFAEEAAA
AGVDGVLTVDLPPEEAAPFTQAFAANDLCPIFLVAPTTAGERLEAVCQAARGFVYYVAIK
GVTGVAELDVDDIARRVSAVRARTDLPVGVGFGIRDAESAARVGAVADAVIVGSALVNRI
AGLTEQPERVPAVLAEALGEMRRALDGLAEEVAS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtctggaaaagcgcatgtcggcctgccggaaggcggggcgcaaggccctgatc
ccctatatcaccgccggcgaccccggcccggagcacaccgtgcccctcatgcacgcgctg
gtcggggccggcgccgacgtcctcgagctcggcgttccgttctccgatccaatggccgac
gggccggtgatccaggccgcctgtgagcgggcactggcccacgggacgaccctgcgcgat
gtcttcgatatggtgcgccggttccgtgagcaggatggcgagacccccgtggtcctgatg
ggttacctcaacccggtggaatacctggggccggcggtctttgctgaggaggcggcggcc
gcgggggtggacggggtactcacggtggacctcccgccggaggaggcggccccctttacc
caggcctttgccgccaatgatttgtgtcccatcttcctggtcgcgccgacaacggcgggt
gaacggctggaggccgtgtgtcaggccgcccgcggctttgtctactacgtggccatcaag
ggcgtcactggcgtggcggaactggatgtggacgatatcgcccgccgggtcagtgccgtg
cgggcccgcaccgacctgccagtgggtgtcggcttcggtatccgcgatgccgagagcgcg
gcgcgggtcggggcggtggccgatgccgttatcgtgggcagtgcgctggtcaatcgcatc
gccgggctgaccgagcagccggagcgggtcccggcggtgttggccgaggcgcttggcgag
atgcgccgggcgctggacggtcttgccgaggaggtcgcatcgtga

DBGET integrated database retrieval system