KEGG   Alkalilimnicola ehrlichii: Mlg_1323Help
Entry
Mlg_1323          CDS       T00391                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00010  Glycolysis / Gluconeogenesis
aeh00260  Glycine, serine and threonine metabolism
aeh00680  Methane metabolism
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01200  Carbon metabolism
aeh01230  Biosynthesis of amino acids
Module
aeh_M00002  Glycolysis, core module involving three-carbon compounds
aeh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlg_1323
  Energy metabolism
   00680 Methane metabolism
    Mlg_1323
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlg_1323
Enzymes [BR:aeh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mlg_1323
Membrane trafficking [BR:aeh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Mlg_1323
Exosome [BR:aeh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mlg_1323
  Exosomal proteins of melanoma cells
   Mlg_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABI56672
UniProt: Q0A915
Position
complement(1526351..1527049)
Genome map
AA seq 232 aa AA seqDB search
MKKLVLLRHGQSIWNQENRFTGWHDVDLTEKGREEAQAAGQLMKRHGLRFDYAYTSVLKR
AIRTLWIGLDELDQMWIPVTKAWQLNERHYGALTGLNKAETAEEYGAEQVHIWRRSYDTP
PPPLDETSPYHPRHDPRYASLKPEQLPATESLALTLERVLPYWNERIVPTLRDCDNVLIA
AHGNSIRALIKHLDGLDDEAIMKVEIATGDPLVYELDDALAVVDKHYLRERD
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttgttttactccgccacgggcaaagcatctggaaccaggaaaaccggttc
accggctggcacgacgtcgacctgaccgaaaagggccgggaagaggcccaggccgccggt
cagctgatgaaacggcacggcctgcgcttcgactacgcctacacctccgtgctcaagcgc
gctatccgcacgctctggatcggactggatgagctggaccagatgtggatccccgtcacc
aaggcgtggcaactcaacgagcgccactacggtgcccttactggcctgaacaaggcggag
accgccgaggaatacggcgccgaacaggtccatatctggcgccgcagctacgacactcct
cctcctccgctggacgaaaccagcccctaccaccccaggcacgacccgcgctacgccagc
ctcaaaccggagcagctcccggcgaccgagtccctggccctgaccctggagcgggtcctg
ccctactggaacgaacgcatcgtgcccaccctgcgtgattgcgacaacgtgctgatcgcg
gcccacggcaacagcatccgggccctgatcaaacacctggacgggctggacgacgaggcc
atcatgaaggtggagatcgccaccggcgaccccttggtctacgaactcgatgacgccctc
gcggtggtggacaagcactacctccgggagcgggattga

DBGET integrated database retrieval system