KEGG   Alkalilimnicola ehrlichii: Mlg_1333Help
Entry
Mlg_1333          CDS       T00391                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00020  Citrate cycle (TCA cycle)
aeh00190  Oxidative phosphorylation
aeh00650  Butanoate metabolism
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01200  Carbon metabolism
Module
aeh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aeh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aeh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mlg_1333
   00650 Butanoate metabolism
    Mlg_1333
  Energy metabolism
   00190 Oxidative phosphorylation
    Mlg_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ABI56682
UniProt: Q0A905
Position
1532982..1533362
Genome map
AA seq 126 aa AA seqDB search
MNLRTNIKEAQGLGSAKDGVSHWWLQRLTAVALVPLMLWLAFGLARHGGAGYEATVAWVA
NPMTTVLWVLSLAALFWHIKLGLQVVIEDYVHDERAKFASLIAMKFITVLLAAIAILAVL
RVALGS
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaggacgaatatcaaagaggcgcagggcctgggctctgccaaggacggggtc
agccattggtggctgcaacggctcaccgccgtggccctggttcccctcatgctctggctg
gccttcgggcttgcccgccacggcggggccggctatgaggccaccgtggcctgggtcgcc
aacccgatgaccacggtgctctgggtgctgtccctggcggcgctgttctggcacatcaag
ctgggcctgcaggtggtcattgaggactacgtgcacgacgagagagccaagttcgcgagc
ctgatcgcgatgaaattcatcaccgtgctgctggccgccatcgccatcctggcggtgctg
cgtgtcgcgctggggagctga

DBGET integrated database retrieval system