KEGG   Alkalilimnicola ehrlichii: Mlg_1412Help
Entry
Mlg_1412          CDS       T00391                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00010  Glycolysis / Gluconeogenesis
aeh00071  Fatty acid degradation
aeh00350  Tyrosine metabolism
aeh00625  Chloroalkane and chloroalkene degradation
aeh00626  Naphthalene degradation
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlg_1412
  Lipid metabolism
   00071 Fatty acid degradation
    Mlg_1412
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mlg_1412
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mlg_1412
   00626 Naphthalene degradation
    Mlg_1412
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mlg_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABI56761
UniProt: Q0A8S6
Position
complement(1618506..1619522)
Genome map
AA seq 338 aa AA seqDB search
MEAEDTERTTMRVMALEAPGQALQAQSWPVPEPGIGQLRLRVRACAVCRTDLHVVDGELP
DPVLPIIPGHEIVGVVDRVGEGCQRYRPGDRVGVPWLGHTCGTCDHCRAGRENLCDQARF
TGYQLQGGYAEYAIADERFCFPIPAAYTDAGAAPLLCAGLIGHRSLSMAGDDARRLGIYG
FGAAAHIVAQVARHQERDLYAFTRPGDQKAQAFARALGACWAGPSDRLPPKPLDAAIIFA
PVGDLVPQALRAVRKGGRVVCGGIHMSDIPSFPYAWLWGERSLCSVANLTRADGEAFMAL
APEVPVRTEVVEYPLDQANQALDDLRGGRLQGAAVLIP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagaggatacggaacgcaccaccatgcgggtgatggcgctggaggccccgggg
caggccctgcaggcccaatcctggcccgtcccggagcccggcatcgggcaactccgcctc
cgggtgcgcgcctgcgccgtctgccgcacggatctgcacgtggtggacggcgagttgccg
gaccccgtactgcccatcatcccgggccatgagatcgtcggtgtggtggaccgcgtgggc
gagggctgccaaaggtaccgcccgggcgaccgggtgggggtgccctggctcggccatacc
tgcgggacctgcgatcattgccgcgccggccgggaaaacctctgcgaccaggcacggttc
accggctaccagttgcagggcggttacgctgaatacgccatcgccgacgagcggttctgc
ttcccgatccccgccgcgtacaccgacgccggcgccgcgccactgttgtgcgccgggctc
atcggtcaccgctcactgagcatggccggcgacgacgcccgccgtctggggatctacggt
ttcggtgcggcggcccatatcgtggcccaggtggcgcgccaccaggagcgcgacctctac
gccttcacccgtccgggggatcaaaaggcccaggcgtttgcccgcgccctcggcgcctgc
tgggccgggccctcggaccggctgccacccaagccattggacgcggccatcatctttgcc
cccgtcggcgacctggtcccccaggccctgcgtgcggtgcgcaagggcggccgggtggtc
tgtggcggcatccacatgagcgatatcccctcgttcccctacgcctggctctggggcgaa
cgcagcctctgctcggtcgccaacctgacccgggccgatggtgaggccttcatggccctt
gcgcccgaggtgccggtacgcacggaagtggtggagtaccccctggaccaggccaatcag
gccctggatgacctgcgcggcggtcgcctgcagggcgccgccgtgctgatcccttag

DBGET integrated database retrieval system