KEGG   Alkalilimnicola ehrlichii: Mlg_1857Help
Entry
Mlg_1857          CDS       T00391                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00900  Terpenoid backbone biosynthesis
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mlg_1857
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Mlg_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Sacchrp_dh_NADP Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABI57201
UniProt: Q0A7I6
Position
complement(2117483..2118688)
Genome map
AA seq 401 aa AA seqDB search
MVAHDAVTGLSILGATGSIGTSTLDVVARHPDRFRVRALAAHRDVAGMAGLCRRFRPELA
VMADPDAAVALRRQLGDDLPGVRVAGGEAGLIEAATWPGVDCVVAAIVGAAGLMPTLAAA
RDGRRILLANKEVLVMAGELFMAEARAHGAVVLPVDSEHNAIFQCLPEAYPARDLDSLGI
RRLILTASGGPFRARAPETLAQVTPDEACAHPNWSMGRKISVDSATMMNKGLELIEACRL
FSAEPGRVDVVIHPQSIVHSLVEYRDGSLLAQLGQPDMRIPIAHALGWPERLVSGAESLD
LAALARLDFEAPDPRRFPCLQLAYDALEAGGHACAVLNAANEVAVEAFLHGEIGYTRIAV
VVAEVLERMSGGPAAADLEAIRGVDNEARSVALQVVRREAG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggtggcacacgacgctgtaaccggattgagcatcctgggagccaccggctccattggc
accagcacgctcgacgtggtggcgcgccacccggaccgattccgggtccgggcgctggcc
gctcatcgggacgtggcaggcatggcgggcctttgtcgccggtttcggccggagctggcg
gtgatggccgacccggacgcggccgtggcgctgcgccgccagctcggtgacgacctcccc
ggtgtgcgggtggccgggggcgaggccgggttgatcgaggcggcgacctggcctggcgtg
gactgcgtggtcgccgccattgtcggggccgccgggttgatgcccaccctggccgccgcc
cgggacggccgccggatcctgctcgccaacaaggaggtgctggttatggccggcgagctg
ttcatggccgaggcccgcgcccatggggccgtggtgctgccggtggacagtgagcacaac
gccatcttccagtgcctgcccgaggcctatccggcccgcgatctcgacagcctggggatc
cgccggctgatcctcaccgcctccggcggaccgttccgggcccgggcaccggagaccctc
gcccaggtgaccccggacgaggcctgcgcccatcccaattggtccatggggcgcaaaatc
tcggtggactcggcgaccatgatgaacaagggcctggagctgattgaggcctgccggttg
ttctcggcggaacccgggcgtgtggatgtggtcattcatccacagagcatcgtgcactcc
ctggtggagtatcgggatggctcgctgctggcccagctgggccagccggatatgcggata
ccgattgcccatgccctgggctggcccgagcgattggtatcgggtgcggagtcgttggac
ctggccgcattggcgcgcctggacttcgaggcgcctgacccgcgccgtttcccctgcctg
cagttggcctacgatgcgctggaggccggggggcacgcctgtgcggtgctcaacgccgcc
aatgaggtggcggtggaggccttcctgcacggggagatcggttatacccggatcgccgtc
gtggtggcggaagtactggagcggatgagtggcgggccggcggcggccgacctggaggcc
atccgcggggtggacaacgaggcgcggtcggtggccctgcaggtcgtgcggcgagaggcg
ggataa

DBGET integrated database retrieval system