KEGG   Alkalilimnicola ehrlichii: Mlg_2461Help
Entry
Mlg_2461          CDS       T00391                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00362  Benzoate degradation
aeh00620  Pyruvate metabolism
aeh00621  Dioxin degradation
aeh00622  Xylene degradation
aeh00650  Butanoate metabolism
aeh01100  Metabolic pathways
aeh01120  Microbial metabolism in diverse environments
aeh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mlg_2461
   00650 Butanoate metabolism
    Mlg_2461
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mlg_2461
   00622 Xylene degradation
    Mlg_2461
   00621 Dioxin degradation
    Mlg_2461
Enzymes [BR:aeh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mlg_2461
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Mlg_2461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh TrkA_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABI57801
UniProt: Q0A5T6
Position
2795811..2796713
Genome map
AA seq 300 aa AA seqDB search
MKIQCAIIGSGNIGTDLMAKLQRSPVLEPAWMVGIDPDSDGLARARAAGLKTTHEGVDGL
LPHIEGDGVRIAFDATSAYVHAENDRKLQEKGVMVIDLTPAAIGPFCVPPVNLKDRIGDG
ATNVNMVTCGGQATVPIVAAVSQVQPVDYAEIVATISSRSAGPGTRKNIDEFTRTTSRAI
EQVGGAKQGKAIIILNPAEPPLIMRDTVHCLVQGKPDHKAITESIERMVAEVQRYVPGYR
IKNGPTFDGQRVSTFLEVEGLGDYLPHYSGNLDIMTAAAARAAEIFAESLQSASDAPATA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccaatgcgccattatcggctccggcaacatcggcaccgacctgatggccaaa
ctgcaacgcagcccggtgctggaacccgcgtggatggtgggcatcgatccggactccgac
ggtctcgcccgcgcccgtgcggccggcctgaagaccacccacgaaggcgtggacggcctg
ctgccgcacattgagggggacggcgtgcgcatcgccttcgatgccacctccgcctacgta
catgccgagaacgaccgcaagctccaggagaaaggggtcatggtcattgacctgaccccg
gccgccatcgggcccttctgcgtcccgccggtcaatctcaaggaccgaatcggcgacggc
gccaccaacgtcaacatggtgacctgcggcggccaggcgacggtccccatcgtcgcggcg
gtcagccaggtacagccggtggactatgccgagatcgtggccaccatctcctcccggtcc
gccgggccgggcacccgcaagaacatcgatgagttcacccgcaccacctcgcgggccatc
gaacaggtgggcggcgccaaacagggcaaggccatcatcatcctcaatcccgccgagccg
ccattgatcatgcgcgacaccgtgcactgcctggtgcaaggcaaaccggaccacaaggcc
atcaccgagtccatcgaacggatggtggccgaggtgcagcgctacgtaccgggctaccgg
atcaagaatggccccaccttcgacggtcagcgggtgagcactttcctggaggtagagggc
ctgggcgactacctgccccattactccggcaacctggacatcatgaccgcggcagccgcc
cgcgccgccgagatcttcgccgagagcctgcaatcggcgtccgacgcaccggccactgcc
taa

DBGET integrated database retrieval system