KEGG   Alkalilimnicola ehrlichii: Mlg_2547Help
Entry
Mlg_2547          CDS       T00391                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00020  Citrate cycle (TCA cycle)
aeh00640  Propanoate metabolism
aeh00660  C5-Branched dibasic acid metabolism
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
aeh01130  Biosynthesis of antibiotics
aeh01200  Carbon metabolism
Module
aeh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aeh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mlg_2547
   00640 Propanoate metabolism
    Mlg_2547
   00660 C5-Branched dibasic acid metabolism
    Mlg_2547
Enzymes [BR:aeh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mlg_2547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABI57887
UniProt: Q0A5K0
Position
2889741..2890916
Genome map
AA seq 391 aa AA seqDB search
MNLHEFQAKHLFADYDIPIPQGYVARSSGEAVEAAGRLGGSVWVVKAQVHAGGRGKAGGV
KVLKTKEEVEEFTDSLLGSRLVTHQTDAKGQPIHAVLVEQGLDIARELYLGALVDRASKR
VTFMGSAAGGMDIEEVAASTPEKILTLAVDPAAGFQAYQGRKMAFALGLEGKQIGQLVKI
MKSLYRIFEEKDLSMIEINPLIVTGDGQLLALDAKVNVDDNAVEIGRQPQIADMRDITQE
DEAEVQAAEHNLNYITLDGNIGCMVNGAGLAMATMDVVNLHGGSPANFLDVGGGTTTERV
TAAFKLILSSDTVEGILVNIFGGIVRCDVIAEGIIAAVKEVGVDVPVVVRLEGTNVEQGK
QMLADSGMDLIPADDLTDAAKKVVAAVGKAA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccatgaatttcaggctaaacacctgtttgctgattacgacatccccatccca
cagggctacgtggcccgctccagcggcgaggcggtcgaagccgccggtcggctgggcggt
tccgtctgggtcgtcaaggcacaggtacacgccggcgggcgcggcaaggcaggcggggtc
aaggtcctcaagaccaaagaagaagtagaagaattcaccgactccctcctgggctcccgc
ctcgtcacccaccaaaccgatgccaagggtcaacccatccacgccgttctggtcgagcag
ggcctcgacatcgcccgcgaactctacctgggcgccctagtggaccgcgcgagcaagcgc
gtcaccttcatgggctccgcggccggcggcatggacatcgaggaggtcgccgccagcacc
cccgagaagatcctcaccctggccgtcgacccggccgccggcttccaggcctaccagggc
cggaagatggcctttgcgctgggcctcgaaggcaagcagatcggccaactggtcaagatc
atgaaaagcctgtatcggatctttgaggagaaggatctgagcatgatcgagatcaacccg
ctgatcgtgaccggcgatggccagctgttggccctggacgccaaagtcaacgtggacgac
aacgccgtcgagatcggccgtcagccgcagatcgccgacatgcgcgacatcacccaggag
gatgaggccgaggtccaagccgccgagcacaacctcaactacattaccctggacggcaac
atcggctgcatggtcaacggcgccggtctggccatggccaccatggacgtggtcaacctg
cacggcggctcgccggccaacttcctggacgtgggtggtggcaccaccaccgaacgcgtc
accgcggccttcaagctgatcctctccagcgacacggtggagggcatcctggtgaacatc
ttcggtggcatcgtgcgctgcgacgtgatcgccgagggcatcatcgccgccgtcaaggag
gtgggcgtggatgtccccgtggtggttcgcctggagggcaccaacgtcgagcagggcaag
cagatgctggctgacagcggcatggacctgatccccgccgacgatctcaccgacgccgcc
aagaaggttgtggccgccgtcggcaaggccgcctga

DBGET integrated database retrieval system