KEGG   Alkalilimnicola ehrlichii: Mlg_2640Help
Entry
Mlg_2640          CDS       T00391                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aeh  Alkalilimnicola ehrlichii
Brite
Enzymes [BR:aeh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mlg_2640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_23 MTS GCD14 Methyltransf_4 Methyltransf_32 Methyltransf_12 CMAS NodS Ubie_methyltran PrmA
Motif
Other DBs
NCBI-ProteinID: ABI57980
UniProt: Q0A5A7
Position
complement(2991352..2992014)
Genome map
AA seq 220 aa AA seqDB search
MTELDLDKARFNMVEQQVRPWDVLASDVLEVMSSVPRHAFVPEDYQRLAYSDMQLPLPCG
EYMNEPKVEGRILQALAPEPGERALEIGTGSGFLAACLARMAASVVSVEIHDELVQRART
IHQARGIDNVTVQQGDAAAGFDDGRRYDCIAVTGSLPEFHEGFHRSLTIGGRLFLIVGQK
PAMEALLITRVAEDQWASVSLFETVQPPLHNAPVSRRFAL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgacggaactggatctggacaaggcgcgcttcaatatggtcgagcagcaggtgcgcccc
tgggacgtgctggccagcgacgtgctcgaggtgatgagcagcgtgccgcgccacgccttc
gtgcccgaggactatcagcggctggcctattccgatatgcagctgccgctgccctgtggc
gaatacatgaacgagcccaaggtcgagggccgtatcctgcaggccctggccccggagccc
ggggagcgggcgctggagatcggcaccggcagcggtttcctggccgcctgcctggcgcgg
atggccgcctctgtggtctcggtggaaatccacgacgagctggtgcagcgggcccggacc
atccaccaggcgcggggcatcgacaacgtcaccgtgcagcagggcgatgccgccgccggt
ttcgatgacggccgtcgctatgactgtatcgcggtcaccggctcgctgcccgagtttcac
gagggctttcaccgcagcctgaccatcggcggccgattgttcctgatcgtcggccagaag
cccgccatggaggcgctgctgatcacccgggtggccgaggaccagtgggcctccgtgagc
ctgttcgagacggtgcagccgccgctgcacaatgccccggtcagccgccggttcgccctg
tag

DBGET integrated database retrieval system