KEGG   Alkalilimnicola ehrlichii: Mlg_2669Help
Entry
Mlg_2669          CDS       T00391                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
aeh00860  Porphyrin and chlorophyll metabolism
aeh01100  Metabolic pathways
aeh01110  Biosynthesis of secondary metabolites
aeh01120  Microbial metabolism in diverse environments
Module
aeh_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mlg_2669
Enzymes [BR:aeh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mlg_2669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABI58009
UniProt: Q0A578
Position
complement(3021949..3022734)
Genome map
AA seq 261 aa AA seqDB search
MALPAGYGVLVTRPAHQAAGLCRTLEAAGARVWALPTLEIVPQPESALPAAAVAALGEAD
WLIFVSPNAVHHGLACMARHGVRPRPDARIAAVGKGTERALHRVGLSVTAVPQAGFTSED
LAREPAFGDMRGQRVMIVRGDSGRAWLAEHLRGQGAEVAFLAVYRAVRPQVDAQPVVEAL
QAGRLHSVIITSVRGLDNLWFMLGDSGRVLVQRRALVTVSPRIARYAEQAGHTGPVVVAR
SPADEDLLQAVHQASEHHNTR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccggccggttacggtgtgctggtgacccgcccggcccaccaggcggcgggc
ctgtgccggaccctggaagcggccggtgcgcgggtctgggcgctgcccaccctggagatc
gtgccgcagccggaatcggcactgcccgcggccgccgtggcggcccttggagaggccgat
tggctcatcttcgtcagccccaacgccgtgcaccacggcctggcctgcatggcccggcac
ggcgtccggccgcgcccggatgcccggatcgcggccgtgggcaagggcactgagcgggcc
ctgcaccgggtcgggctgtccgtcaccgccgtaccgcaggccggtttcaccagcgaagac
ctggcgcgggagccggcctttggtgacatgcgcgggcaacgtgtcatgatagttcgtggc
gacagcggtcgcgcctggctcgccgagcacctgcgcgggcagggtgccgaggtggcgttc
ctggccgtctaccgggcggtccggccccaggtggacgcgcaaccggtggttgaggcgttg
caagccgggcgtttgcacagtgtcataatcaccagtgtgcggggtttggataatctatgg
tttatgctgggggatagcgggagagtattagttcaacgacgggcgctggtgacagtcagc
ccgcgtatcgcccgctacgcggagcaggcgggccacaccggccccgtagtggtggcccgc
tccccggccgatgaggacctgttacaggcggtccatcaggcatcagaacatcacaacacg
agatga

DBGET integrated database retrieval system