KEGG   Acinetobacter equi: AOY20_01690Help
Entry
AOY20_01690       CDS       T04103                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
aei  Acinetobacter equi
Pathway
aei00430  Taurine and hypotaurine metabolism
aei00620  Pyruvate metabolism
aei00640  Propanoate metabolism
aei00680  Methane metabolism
aei01100  Metabolic pathways
aei01120  Microbial metabolism in diverse environments
aei01200  Carbon metabolism
Module
aei_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:aei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOY20_01690
   00640 Propanoate metabolism
    AOY20_01690
  09102 Energy metabolism
   00680 Methane metabolism
    AOY20_01690
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AOY20_01690
Enzymes [BR:aei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AOY20_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: ALH94356
UniProt: A0A0N9WAH4
Position
369272..370492
Genome map
AA seq 406 aa AA seqDB search
MSTSILVINCGSSSIKYALVSDRREDRIFGLAENLGSPEARIKGITVGGEALELSIPNAD
HEKALETILERLSHYNPQAIGHRVVHGGTLTKAELLTPEIVQRIREATPLAPLHNPAHLV
GIDATMRLFPELPQVAVFDTAFHQTMPSHAYRYALPKFLYTQHNVRRYGFHGTSHAYVSD
RGSELAGSFREGGWLTAHLGNGSSTCAIWNGQSVDTSMGLTPLEGVVMGTRSGDVDPSIH
SFLATNLGWDIYKIDKMLNSQSGLLGLSDLSNDMRTLIEASEQGNEDATLAIEVFCYRLA
KSLAGLSCGLPRIDGLFFTGGIGENSAYIREKTMSYLPHFGFNLSKEKNDELKRGTEGRI
DAGVGPQIWVVPTDEEGRIAKETIHVVETEVHQTTGKKLKAQAMMA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgtctacatctatcttagttattaactgtggttcttcatccattaaatatgctttagta
tctgatcgacgtgaagaccgaatttttggtttagcagaaaacttaggttctcctgaagca
cgtattaaaggtattacggtcggaggtgaagctttggaattatctattccaaatgcagac
catgaaaaagctttagaaacgattttagaacgtttatctcattataacccccaagcgatt
ggtcaccgtgtcgtacacggtggtactttaaccaaagcagaattacttactcctgaaatt
gtacaacgcattcgtgaggcaactcctctagcaccattgcataaccctgctcatttagtc
ggtattgatgcaacaatgcgtttattccctgaacttccacaagttgctgtttttgatact
gcattccatcaaacaatgccatcacatgcgtatcgttatgctttacccaaatttctctac
acccaacataatgtacgtcgttacggtttccatggtacaagtcatgcttatgtttctgac
cgcggttcagaacttgctggaagctttagagaaggtggctggttaacagcacatttaggt
aatggtagctcgacttgcgcaatttggaatggtcaaagcgttgatacatctatgggttta
acaccattagaaggtgttgtaatgggaactcgtagtggtgatgttgatcctagtatccat
agcttccttgcaaccaatttaggttgggatatctataaaatagataaaatgctcaatagc
caaagtggtctccttggtttatctgacttatctaatgatatgcgtacattgattgaagct
tctgaacaaggaaatgaagatgctactttagctatcgaagtattctgctatcgcttagca
aaatctctagctggcttaagctgtggtttgccacgtattgatggcttattcttcacaggt
ggtataggagaaaactccgcttatatccgtgaaaaaaccatgtcttacctccctcacttt
ggttttaatctcagtaaagaaaaaaatgatgagttaaaacgcggtacagaaggtcgtatt
gatgctggcgttggtccacaaatttgggttgttccaacagatgaagaaggtcgtattgca
aaagaaaccattcatgttgtggaaacagaggttcatcagacaactggaaaaaagcttaaa
gcacaagcaatgatggcataa

DBGET integrated database retrieval system